Typing tool

Complete norovirus genomes

KJ407074  GII.2
 GII.P16

Length: 7,496 | 3 CDS

ORF1: 5..5101
ORF2: 5082..6710
ORF3: 6710..7489
LOCUS       KJ407074                7496 bp ss-RNA     linear   VRL 17-SEP-2015
DEFINITION  Norovirus Hu/GII.2/HS255/2011/USA, complete genome.
ACCESSION   KJ407074
VERSION     KJ407074.2
DBLINK      BioProject: PRJNA222778
KEYWORDS    .
SOURCE      Norovirus Hu/GII.2/HS255/2011/USA
  ORGANISM  Norovirus Hu/GII.2/HS255/2011/USA
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7496)
  AUTHORS   Das,S., Halpin,R.A., Ransier,A., Fedorova,N., Tsitrin,T.,
            Stockwell,T., Amedeo,P., Bishop,B., Edworthy,P., Gupta,N.,
            Hoover,J., Katzel,D., Schobel,S., Shrivastava,S., Scheuer,K.,
            Takanashi,S., Wang,Q., Wentworth,D.E. and Saif,L.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2014) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
REFERENCE   2  (bases 1 to 7496)
  AUTHORS   Das,S., Halpin,R.A., Ransier,A., Fedorova,N., Tsitrin,T.,
            Stockwell,T., Amedeo,P., Bishop,B., Edworthy,P., Gupta,N.,
            Hoover,J., Katzel,D., Schobel,S., Shrivastava,S., Scheuer,K.,
            Takanashi,S., Wang,Q., Wentworth,D.E., Oka,T. and Saif,L.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUN-2014) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
  REMARK    Sequence update by submitter
COMMENT     On Jun 30, 2014 this sequence version replaced KJ407074.1.
            This work was supported by the National Institute of Allergy and
            Infectious Diseases (NIAID), Genome Sequencing Centers for
            Infectious Diseases (GSCID) program.
            The genome sequence was generated using overlapping PCR amplicons
            spanning the genome. The amplicons were pooled by sample and then
            barcoded and sequenced using Next Generation Sequencing platforms.
            The consensus sequences of the internal PCR primer hybridization
            sites were manually verified using reads from amplicons that
            spanned across the sites.
            
            ##Genome-Assembly-Data-START##
            Current Finishing Status :: Finished
            Assembly Method          :: clc_ref_assemble_long v. 3.22.55705
            Genome Coverage          :: 187.1x
            Sequencing Technology    :: Ion Torrent; Sanger
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7496
                     /organism="Norovirus Hu/GII.2/HS255/2011/USA"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.2/HS255/2011/USA"
                     /host="Homo sapiens; sex: M; age: 3Y"
                     /db_xref="taxon:1458701"
                     /country="USA: Wooster, OH"
                     /collection_date="30-Jan-2011"
                     /PCR_primers="fwd_name: 4_Forward, fwd_seq:
                     accatatgacagctctac, rev_name: 4_Reverse, rev_seq:
                     gacctcctccgcatc"
                     /PCR_primers="fwd_name: 10_Forward, fwd_seq:
                     caraggccyatacagc, rev_name: 10_Reverse, rev_seq:
                     tttgactggttggttgac"
                     /PCR_primers="fwd_name: 7_Forward, fwd_seq:
                     gtgaatgawgatggcgt, rev_name: 7_Reverse, rev_seq:
                     ccagrctrtctttrtctt"
                     /PCR_primers="fwd_name: 8_Forward, fwd_seq:
                     ygactcgtggctgagyagga, rev_name: 8_Reverse, rev_seq:
                     gytgggccctgyagttcawa"
                     /PCR_primers="fwd_name: 9_Forward, fwd_seq:
                     tcaaccaartctgcttcacctg, rev_name: 9_Reverse, rev_seq:
                     aagtcytcctcrgtcgccct"
                     /note="genotype: GII.2"
     gene            5..5101
                     /gene="POL"
                     /locus_tag="T287_42398gpPOL"
     CDS             5..5101
                     /gene="POL"
                     /locus_tag="T287_42398gpPOL"
                     /note="genome polyprotein"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AIE15757.1"
                     /translation="MKMASNDANVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQSAPRDNSQKPPRPPTPELVKRIPPPPPNGEEEEPAIRYEVKGGISGLPELTTVPQP
                     DVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAI
                     SMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLND
                     SWLNRRMVQRTTGFFRPYQEWNRKPLPTVDDSKIKKVANIFLCSLSTLFTRPIKDLIG
                     KIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLEDYELQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLARE
                     VARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADT
                     CPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPDVE
                     KAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERMDEFELQGPTVTTFNFDRNRITAFRQLAAENKYGLVDTMRVGNQLKGVKT
                     MEELKQAIRNVIIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHHL
                     KHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPPLDQNESEAKEEV
                     PKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEELAIAKATEEDFCEEEEVRIRQRIFRPTRKQRKEERATLGLVT
                     GSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPS
                     LFITSTHVIPAGITEAFGVPIKQIQVHKSGEFCRFRFPKPIRPDVTGMILEEGAPEGT
                     VATVLIKRPTGELMPLAARMGTHAAMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDC
                     GCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGP
                     GGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPYHVRKNEFWN
                     GETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKVYGRIKKRLLWGSDLS
                     TMIRCARSFGGLMDEMKAHCTSLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTKLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLKE
                     YGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGPN
                     HEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     5..997
                     /gene="POL"
                     /locus_tag="T287_42398gpPOL"
                     /product="protein p48"
     mat_peptide     998..2095
                     /gene="POL"
                     /locus_tag="T287_42398gpPOL"
                     /product="NTPase"
                     /note="p41"
     mat_peptide     2096..2626
                     /gene="POL"
                     /locus_tag="T287_42398gpPOL"
                     /product="protein p22"
     mat_peptide     2627..3025
                     /gene="POL"
                     /locus_tag="T287_42398gpPOL"
                     /product="viral genome-linked protein"
                     /note="VPg"
     mat_peptide     3026..3568
                     /gene="POL"
                     /locus_tag="T287_42398gpPOL"
                     /product="3C-like protease"
                     /note="3CLpro; calicivirin"
     mat_peptide     3569..5098
                     /gene="POL"
                     /locus_tag="T287_42398gpPOL"
                     /product="RNA-directed RNA polymerase"
     gene            5082..6710
                     /gene="VP1"
                     /locus_tag="T287_42398gpVP1"
     CDS             5082..6710
                     /gene="VP1"
                     /locus_tag="T287_42398gpVP1"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="AHI59159.1"
                     /translation="MKMASNDAAPSTDGAAGLVPESNSEVMALEPVAGAALAAPVTGQ
                     TNIIDPWIRANFVQAPNGEFTVSPRNAPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     MEVQVMLAGNAFTAGKLVFAAVPPHFPVENLSPQQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQKDDPKMRIVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFTYLVPP
                     TVESKTKPFTLPILTLGELSNSRFPVSIDQMYTSPNEVISVQCQNGRCTLDGELQGTT
                     QLQVSGICAFKGEVTAHLHDNDHLYNVTITNLNGSPFDPSEDVPAPLGVPDFQGRVFG
                     VISQRDKHNSPGHNEPANRGHDAVVPTYTAQYTPKLGQVQIGTWQTDDLTVNQPVKFT
                     PVGLNDTEHFNQWVVPRYAGALNLNTNLAPSVAPVFPGERLLFFRSYVPLKGGYGNPA
                     IDCLLPQEWVQHFYQEAAPSMSEVALVRYINPDTGRALFEAKLHRAGFMTVSSNTSAP
                     VVVPANGYFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     gene            6710..7489
                     /gene="VP2"
                     /locus_tag="T287_42398gpVP2"
     CDS             6710..7489
                     /gene="VP2"
                     /locus_tag="T287_42398gpVP2"
                     /note="minor capsid protein"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="AHI59160.1"
                     /translation="MAGAFVAGLAGDVLSNGLSSLINAGANAINQRAEFDFNQKLQQN
                     SFNHDKEMLQAQIQATKQLQADMMAIKQGVLTAGGFSPADAARGAVNAPMTQALDWNG
                     TRYWAPGSMRTTSYSGKFTSTAPVRQADFQHTQSRPSSGSSVSSFATQSSRPTLTTTT
                     GSSHGTASSNSTRSTSLSQSTVSRATSRTSEWVRDQNRNLEPYMHGALQTAFVTPPSS
                     RASDGTVSTVPKGVLDSWTPAFNTRRQPLFAHLRKRGESHA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctaa cgttgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggcc cggcccaaac agtctgcccc gagggacaac tcacaaaagc ccccaagacc
      181 accaactccc gagttggtta agaggatacc ccctccccca cctaatggtg aagaagaaga
      241 accagccatt aggtatgagg ttaagggtgg gatctctggc ctgcccgagc tcacaacagt
      301 cccccaacca gatgtggcca acacggcatt cagtgtccca ccgctgagct tgagagaaaa
      361 cagggaggcc aaggaaccgc tgacaggggc aatattagag atgtgggatg gagagatata
      421 ccactatggc ctgtacgtgg aaaaaggctt agtgttgggt gtgcacaaac cacctgcagc
      481 tataagcatg gcaaaagtgg agctgacgcc gttgtcattg tactggcgtg tggtctacac
      541 cccccaatac ctcatctccc ctgaaactct caggaggctc aacggagagg cattccctta
      601 caccgccttt gacaacaact gctatgcctt ttgctgctgg gtattagacc tcaatgactc
      661 atggcttaac aggaggatgg tgcaaagaac aacaggcttc ttcagacctt accaagagtg
      721 gaacagaaaa cccctgccta ctgtggatga ctccaaaatc aagaaggtgg caaacatatt
      781 cctgtgttca ttgtccacgt tgttcaccag acctataaaa gacctcatag gaaaaattaa
      841 accattaaac atcttgaaca tcctggcaac gtgtgactgg acattcgccg gaatagtgga
      901 gtctctgata ttacttgctg agctctttgg agttttctgg acacccccag atgtgtctgc
      961 tatgatcgct cccttacttg aagactacga gttgcaaggg ccagaagacc tcgccgttga
     1021 gctcgtacct gtggtaatgg gagggattgg tttggtgttg ggattcacca aagagaaaat
     1081 tggcaaaatg ttgtcctcag cagcatcaac gctcagggct tgtaaagatc ttggtgccta
     1141 tggcttagag atactcaaat tggtcatgaa gtggttcttc ccaaagaaag aagaggccaa
     1201 tgagctagcc atggtgagag ctatagagga tgctgtactg gatcttgagg caatagaaaa
     1261 taatcacatg acaactctgt tgaaagacaa agacagccta gcaacctaca tgaaaaccct
     1321 ggacatggag gaggagaaag ccagaagatt gtccacaaaa tctgcatccc ctgacatagt
     1381 cgggacgatc aacgccctgc tggctcgaat agcagcggca aggtcactag tccacagggc
     1441 caaggaggag ttatctagca ggataagacc agtagttgtt atgatatctg gcaaaccagg
     1501 gataggtaaa actcatttgg ccagggaagt ggcaagaaag gtggcatcca ctctcacagg
     1561 ggatcaaaga gtcggactca taccgagaaa cggtgtggac cattgggatg catacaaagg
     1621 tgagagagtc gtgctgtggg acgactatgg catgagtaac cccattcatg atgctttgcg
     1681 catacaagaa ttggctgata cgtgtcccct taccttaaat tgcgacagaa ttgaaaataa
     1741 gggaaaagtt tttgacagtg aagttataat aattacaaca aaccttgcca atccagctcc
     1801 acttgattat gtcaactttg aggcttgttc caggagaatt gacttcctgg tgtacgccga
     1861 ggcaccagat gtagaaaagg caaaacgaga ctttcctggt caaccagata tgtggaagga
     1921 cgcattcaag tcggactttt cacatatcaa gttgcaactt gcacctcagg gcggctttga
     1981 caagaatggc aacaccccac atggtaaagg agtgatgaag accctcacca ccggttccct
     2041 gattgcccgt gcatcaggct tactgcatga gaggatggac gaatttgaac tccaaggccc
     2101 cacagttacc accttcaatt tcgatcggaa cagaatcacc gcattcagac aattggctgc
     2161 agaaaacaag tatgggttgg tggacaccat gagagttggc aatcaattaa aaggggtgaa
     2221 aaccatggaa gaactcaaac aagcaatcag gaatgtgatc atcaagaggt gccggatcat
     2281 ctacggtggc tccacgtatg accttgaatc tgatggcaag ggcaaagttt tggtggaaaa
     2341 ggtcaagaac acctctgtac agaccaacaa cgagttggcc ggagccctgc atcacctcaa
     2401 acatgcccga atcaggtact atgtcaaatg tgtgcaagaa gcagtttact ctatcataca
     2461 aattgccggc gctgcgtttg tcaccacacg cattgcacgc cgcatgaaca tacaagagct
     2521 ttggtcgaag ccaccattag accaaaatga atcagaggct aaggaagagg tccccaagtc
     2581 agaagatgac gagttcatca tatcttctaa ggacatcaag gaggaaggaa agaagggcaa
     2641 aaacaaaact ggccgtggca agaaacacac tgcattctct agcaagggct tgagcgatga
     2701 ggagtatgac gagtacaaga ggataagaga agagagaaat gggaagtact ctatagagga
     2761 gtatcttcaa gacagagaca ggtactatga ggaactcgcc atcgccaagg ccacggaaga
     2821 ggacttctgt gaggaggagg aggtcagaat ccgtcagagg atcttccgtc ccaccaggaa
     2881 acaaaggaag gaagagaggg ccacactagg actagtaact ggttcagaaa tcagaaaaag
     2941 aaaccctgat gacttcaaac ctaaagggaa actgtgggcc gatgacaaca gaagtgttga
     3001 ctacaatgag aaactggact ttgaggcccc cccaagcata tggtctagga ttgtgagctt
     3061 tggttctggt tggggcttct gggtatcacc aagcctgttc ataacatcaa ctcatgtaat
     3121 ccctgcaggc ataacagagg catttggagt ccccatcaaa caaatccagg tccacaaatc
     3181 aggtgaattt tgccggttca gattcccaaa accaattaga ccagatgtga caggaatgat
     3241 cttggaagaa ggtgcgcctg agggcaccgt ggcaaccgtg ctcatcaaac gccctaccgg
     3301 agagctcatg ccccttgcag ccagaatggg gacacacgca gccatgaaaa ttcagggccg
     3361 catggttggc ggacagatgg gtatgttgct cactggttca aatgctaaag gaatggattt
     3421 gggaacaact cctggtgatt gtggctgtcc ctacatctac aaaaggggca atgactatat
     3481 agtcattggt gtgcacacag cagcagcccg tggtggaaac accgtcatct gtgccacaca
     3541 gggaagtgag ggtgaggcaa ctcttgaggg tggagatgac aaaggaacat actgtggggc
     3601 acccattcta ggccccgggg gggcaccaaa attgagcacc aaaaccaaat tttggaggtc
     3661 atcgaacacg cctcttccac cagggacata tgagcctgcc tacctcggtg gccgcgaccc
     3721 gcgtgtcaag ggagggccct ccttgcagca ggtaatgaga gaccagttga aaccattcac
     3781 tgaacccagg ggtaaacctc caagaccaag tgtgttggaa gcagccaaac aaaccatcat
     3841 caatgttctc gaacaaaccc tggaccctcc acaaaaatgg acgtacgcac aggcgtgtgc
     3901 ttcacttgac aaaaccacct ccagcgggca tccctatcac gtccgaaaga atgaattctg
     3961 gaatggtgag accttcactg gtaaattggc agaccaagca tcaaaagcaa atctgatgtt
     4021 tgaggaaggg aagcacatga caccagtgta tacagcagcc cttaaggacg agctggtcaa
     4081 gactgacaaa gtctatggaa ggatcaagaa gagattgctc tggggctctg acttgtccac
     4141 catgatccgg tgcgccaggt cctttggtgg gctcatggat gagatgaagg cacactgcac
     4201 atcactccca gtccgagttg gcatgaacat gaatgaagat ggtccaataa tatttgagaa
     4261 gcactccaga tacaagtacc actatgatgc agactactcc cgctgggatt caacacaaca
     4321 gagggcagta ctagcagcag ccttggaaat catggtcagg ttctctgcag agccacaatt
     4381 ggcacagata gtcgctgagg atctgctggc ccccagtgtg gtagatgtag gagactttaa
     4441 aatttcaata aatgaagggc tcccctctgg tgtaccatgc acttctcaat ggaattccat
     4501 cgcacactgg ctgctaaccc tctgtgcctt gtctgaagtc accaaactgt cccctgacat
     4561 tgtacaggca aattccatgt tctcatttta cggtgatgac gagattgtca gcaccgatat
     4621 aaaattggac cctgaaaagt tgaccaccaa attgaaggag tacggcctga aaccaactcg
     4681 cccagacaaa accgagggac ccctgatcat cagtgaggat ttgaacggac tcacttttct
     4741 ccggaggacg gtgactcgtg acccagctgg ctggtttgga aaattggacc aaagttcaat
     4801 attgaggcag atgtactgga ctagagggcc aaatcatgaa gaccccaatg agacaatgat
     4861 accccactct caaagaccca tacagctcat ggcactgctt ggtgaggcct cccttcacgg
     4921 accctctttc tacagcaaaa tcagtaaatt ggtcataact gaactcaaag aaggtgggat
     4981 ggacttttac gtgccaaggc aggaacccat gttcaggtgg atgaggttct ctgacttgag
     5041 cacgtgggag ggcgatcgca atctggctcc caattttgtg aatgaagatg gcgtcgaatg
     5101 acgccgctcc atctactgat ggtgcagccg gcctcgtgcc agaaagtaac agtgaggtca
     5161 tggctcttga acccgtggct ggtgccgcct tggcagcccc ggtcaccggt caaacaaata
     5221 ttatagaccc ttggattaga gcaaattttg tccaggcccc caatggcgaa tttacagtct
     5281 ctccccgtaa tgcccctggt gaagtgctac taaatctaga gttgggtcca gaattaaatc
     5341 cttatctggc acatttagca agaatgtaca acgggtatgc cggtgggatg gaggtgcagg
     5401 tcatgttagc tgggaacgcg ttcacagccg gcaagttggt cttcgccgcc gtgccacctc
     5461 acttcccggt tgaaaacctt agcccacagc aaattaccat gttccctcat gtgattatag
     5521 atgtaaggac cttggaacct gttttattac cactccctga tgttaggaat aatttcttcc
     5581 actataatca gaaagatgat cctaaaatga gaattgtggc tatgctttat acccccctta
     5641 ggtctaatgg ttcaggtgat gatgtgttca cagtttcctg cagggtgttg actagaccct
     5701 cccctgattt tgacttcaca tatctggtgc caccaacagt ggaatctaaa acaaaaccat
     5761 tcaccctccc aatcctcaca cttggggaac tttccaattc taggttccca gtgtccatag
     5821 accagatgta caccagccct aatgaagtta tatcagtgca gtgtcaaaat ggtaggtgca
     5881 cattggacgg ggagcttcag gggacaacac aactccaagt cagtggcatt tgtgctttca
     5941 agggggaagt gaccgcccac ttgcatgaca atgatcacct atacaatgtc accatcacaa
     6001 acttgaatgg gtcccctttt gacccctccg aggacgttcc tgcccctctg ggcgtgcctg
     6061 acttccaggg aagggtcttt ggtgtcatct cccaaagaga caaacacaat agccctgggc
     6121 ataatgaacc agcaaacagg ggacacgacg ctgtggtccc tacttacaca gcacagtaca
     6181 ctccaaaatt gggtcaggtt caaattggca catggcagac cgacgatctt acagtcaacc
     6241 aaccagtcaa attcacccca gttggactca atgacactga acattttaat caatgggtgg
     6301 tccccagata cgctggtgcc ctaaacctca acacaaacct tgccccttct gttgctccag
     6361 tatttccagg ggagcgcctg cttttcttca gatcatacgt tcccctcaag ggtggttatg
     6421 gaaatccagc cattgattgc ctattaccac aagagtgggt gcaacacttc tatcaggagg
     6481 ctgccccatc aatgagtgag gtggcccttg tcaggtacat taacccggat actggtcggg
     6541 cactgtttga ggccaagctc cacagagctg gtttcatgac agtctcgagc aacaccagtg
     6601 ccccggtggt tgtgcctgcc aatgggtact tcagatttga ctcttgggtt aatcaattct
     6661 attctctcgc ccccatggga actggaaatg ggcgtagaag ggttcaataa tggctggagc
     6721 ctttgtagct ggtcttgcag gggacgtgct cagcaatggg ctcagttcat taattaatgc
     6781 aggtgccaat gcaataaatc agagggcaga atttgatttt aatcagaaat tacagcaaaa
     6841 ttctttcaat catgataagg agatgttgca ggcccagatc caggcaacta agcagctgca
     6901 ggcagacatg atggctataa aacagggggt cctgacagct ggcggctttt cccctgctga
     6961 tgcagccaga ggtgctgtga atgcgcccat gacacaggcg ctggattgga acggcacaag
     7021 gtattgggca ccaggctcta tgaggaccac atcttattct ggaaaattta catcaaccgc
     7081 cccagtgagg caggccgact tccagcacac ccaaagccgg ccttcgagtg gttcttctgt
     7141 gtcctccttt gccactcagt cttcaaggcc aactctgacc acaaccactg ggtcctcaca
     7201 tggcacagcc tcatcaaatt caactcgcag cacaagcctc tcccaatcaa cggtctctag
     7261 agctacatct aggactagtg agtgggttag agatcaaaat agaaatttgg aaccctacat
     7321 gcatggtgcc ttacagacgg cctttgtcac cccaccttcc agcagggcgt ctgacgggac
     7381 agtctcaacc gtcccaaaag gtgttttgga ctcctggaca cctgcgttca acacccgcag
     7441 gcagccgctc tttgcacacc tccgtaagag gggggagtca catgcttagt gaaaag
//