Typing tool

Complete norovirus genomes

KJ407072  GII.6
 GII.P7

Length: 7,526 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6722
ORF3: 6722..7501
LOCUS       KJ407072                7526 bp ss-RNA     linear   VRL 17-SEP-2015
DEFINITION  Norovirus Hu/GII.6/HS245/2010/USA, complete genome.
ACCESSION   KJ407072
VERSION     KJ407072.2
DBLINK      BioProject: PRJNA222778
KEYWORDS    .
SOURCE      Norovirus Hu/GII.6/HS245/2010/USA
  ORGANISM  Norovirus Hu/GII.6/HS245/2010/USA
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7526)
  AUTHORS   Das,S., Halpin,R.A., Ransier,A., Fedorova,N., Tsitrin,T.,
            Stockwell,T., Amedeo,P., Bishop,B., Edworthy,P., Gupta,N.,
            Hoover,J., Katzel,D., Schobel,S., Shrivastava,S., Scheuer,K.,
            Takanashi,S., Wang,Q., Wentworth,D.E. and Saif,L.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2014) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
REFERENCE   2  (bases 1 to 7526)
  AUTHORS   Das,S., Halpin,R.A., Ransier,A., Fedorova,N., Tsitrin,T.,
            Stockwell,T., Amedeo,P., Bishop,B., Edworthy,P., Gupta,N.,
            Hoover,J., Katzel,D., Schobel,S., Shrivastava,S., Scheuer,K.,
            Takanashi,S., Wang,Q., Wentworth,D.E., Oka,T. and Saif,L.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JUN-2014) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
  REMARK    Sequence update by submitter
COMMENT     On Jun 30, 2014 this sequence version replaced KJ407072.1.
            This work was supported by the National Institute of Allergy and
            Infectious Diseases (NIAID), Genome Sequencing Centers for
            Infectious Diseases (GSCID) program.
            The genome sequence was generated using overlapping PCR amplicons
            spanning the genome. The amplicons were pooled by sample and then
            barcoded and sequenced using Next Generation Sequencing platforms.
            The consensus sequences of the internal PCR primer hybridization
            sites were manually verified using reads from amplicons that
            spanned across the sites.
            
            ##Genome-Assembly-Data-START##
            Current Finishing Status :: Finished
            Assembly Method          :: clc_ref_assemble_long v. 3.22.55705
            Genome Coverage          :: 181.2x
            Sequencing Technology    :: Ion Torrent; Sanger
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7526
                     /organism="Norovirus Hu/GII.6/HS245/2010/USA"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.6/HS245/2010/USA"
                     /host="Homo sapiens; sex: M; age: 4Y"
                     /db_xref="taxon:1458705"
                     /country="USA: Wooster, OH"
                     /collection_date="21-Dec-2010"
                     /PCR_primers="fwd_name: 2_Forward, fwd_seq:
                     gtgaatgawgatggcgt, rev_name: 2_Reverse, rev_seq:
                     cactatatcaggtgaagc"
                     /PCR_primers="fwd_name: 12_Forward, fwd_seq:
                     aaacagaatgcygctgg, rev_name: 12_Reverse, rev_seq:
                     ttttcaccttttcactaagc"
                     /PCR_primers="fwd_name: 1_Forward, fwd_seq:
                     gtgaatgawgatggcgt, rev_name: 1_Reverse, rev_seq:
                     ttggttgagagyttyctg"
                     /PCR_primers="fwd_name: 4_Forward, fwd_seq:
                     ggcaagaagcacacagcctt, rev_name: 4_Reverse, rev_seq:
                     crrctctytgttgtgttgaatccc"
                     /PCR_primers="fwd_name: 7_Forward, fwd_seq:
                     gtgaatgawgatggcgt, rev_name: 7_Reverse, rev_seq:
                     ccagrctrtctttrtctt"
                     /note="genotype: GII.6"
     gene            5..5098
                     /gene="POL"
                     /locus_tag="T287_42397gpPOL"
     CDS             5..5098
                     /gene="POL"
                     /locus_tag="T287_42397gpPOL"
                     /note="genome polyprotein"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AHI59153.1"
                     /translation="MKMASNDATTALGSQNSVNDSINTAPSNKEEVGAFSNIKVGFKK
                     ILGAVPKGTKAPSSDQRCPTVKIGTKTLTVPPEPPNGEDAVQFDAKSETVRGLPDLTT
                     VQNEHENTPYTVPPLSEREHRPATEPLPGTILEMWDGEFYHYSVYVSGGKALGVHKPP
                     AAISLATIELTPISLYWRPVYTPNYLVCPETLKGLAGEKFPYTAFSNNCYNFCCWVLE
                     LNDTWLSRKSISRTTGFFKPYQSWNRRPLPTVDDGKIKKVANAILCALGSLFSKPIKD
                     LLGKLKPLNLLHLLASCDWTFAGIVETVILMAELFNIFWTPPDVSSFIASLIGDFELQ
                     GPEDLAVELVPVVMGGIGMVLGFTAEKIGRMLSSAASTLRACKDLGNYALDILKLVMK
                     WFFPKKEEKAEMETLRAIEDAVLDMEAIGNNHLTTLLKDKDSLTAFMKTLDLEEEKAR
                     KLSTKSSSPDIVGTINAILARIAAARSLLHKAKEEMFSRIRPVVVMISGRPGIGKTHM
                     ARHLAKSIANTMSGDQRVGLVPRNGVDHWDAYRGERVVLWDDYGMGNPVKDALTLQEL
                     ADTCPVTLNCDRIENKGKMFDSDVIIITTNLVNPAPLDYVNFEACSRRVDFLVYAESP
                     EIEKVKRDFPGQPDMWKDHFKPDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSL
                     TARVAGLVHERRDEFQLQGNDLQTYNFDTNRVSAFRKLAADNKYGIMETMRVGTALKS
                     VKTLEDLKVALRDVKFNECEIIYRNSKYRVSSNGKGSVSVDKVEGQTSQTANEVGAAL
                     LRLRQARARYYVSCFQDLVYTLIQVAGASFVVNRISKRFCWERWVKPTETQETSESEK
                     EVAQGRWEIEPKDTEPEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEFKRIREERSGKY
                     SIEEYLQDRDRYYEEVAVARATEEDFCEEEEAKIRQRIFRPTKKQRKEERGVLGLVTG
                     SDIRKRRPDDFQPKGNLWADDTRSVDYNERLDFEAPPSVWSRIVPLGTGWGFWVSSNL
                     LITTTHVLPKGIKELFGVEIKQIQIHKSGEFCRFRFPRPIRPDVTGLVLEEGAPEGTV
                     CSVLVKRPTGEMIPLAVRMGTHASMKIQGRTVGGQMGMLLTGANAKNMDLGTGPGDCG
                     CPYIYKRGNDIVVAGVHTAAARGGNTVICATQGQDGEAVLEGNENLGTYCGAPILGPG
                     KAPKLSTKTKFWRSSPDALPPGTYEPAYLGGKDPRVEKGPSLQQVMRDQLKPFTEPRG
                     KPPRPAVLEEAKKTVMNVLEQTIDPAKPWTYSQACASLDKTTSSGSPHHVRKNDHWNG
                     ESFTGPLADQASKANLMYEQAKHVQPVYTAALKDELVKTDKIYKKIKKRLLWGSDLGT
                     MIRCARAFGGLMDSMKASCIALPCRVGMNMNEDGPIIFDKHSKYRYHYDADYSRWDST
                     QQRSILSAAMEVMVRFSAEPELAQVVAEDLLAPSQLDVGDFVISVQEGLPSGVPCTSQ
                     WNSIAHWILTLSAMAEVSGLSPDVVQAHSCFSFYGDDEIVSTDINLDPMKLTQKLREY
                     GLVPTRPDKTEGPLVITEDLTGLTFLRRSIARDPAGWFGKLDQDSILRQLYWTRGPNH
                     ENPYESMVPHSQRATQLMALLGEASLHGPQFYKKVSKMVINEIKSGGLEFYVPRQEAM
                     FRWMRFSDLSTWEGDRNLAPEGVNEDGVE"
     mat_peptide     5..1006
                     /gene="POL"
                     /locus_tag="T287_42397gpPOL"
                     /product="protein p48"
     mat_peptide     1007..2104
                     /gene="POL"
                     /locus_tag="T287_42397gpPOL"
                     /product="NTPase"
                     /note="p41"
     mat_peptide     2105..2620
                     /gene="POL"
                     /locus_tag="T287_42397gpPOL"
                     /product="protein p22"
     mat_peptide     2621..3022
                     /gene="POL"
                     /locus_tag="T287_42397gpPOL"
                     /product="viral genome-linked protein"
                     /note="VPg"
     mat_peptide     3023..3565
                     /gene="POL"
                     /locus_tag="T287_42397gpPOL"
                     /product="3C-like protease"
                     /note="3CLpro; calicivirin"
     mat_peptide     3566..5095
                     /gene="POL"
                     /locus_tag="T287_42397gpPOL"
                     /product="RNA-directed RNA polymerase"
     gene            5079..6722
                     /gene="VP1"
                     /locus_tag="T287_42397gpVP1"
     CDS             5079..6722
                     /gene="VP1"
                     /locus_tag="T287_42397gpVP1"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="AHI59154.1"
                     /translation="MKMASNDAAPSNDGAANLVPEANNEVMALEPVVGASIAAPVVGQ
                     QNIIDPWIRENFVQAPQGEFTVSPRNSPGEMLLNLELGPELNPYLSHLSRMYNGYAGG
                     MQVQVVLAGNAFTAGKIIFAAVPPHFPVENISAAQITMCPHVIVDVRQLEPVLLPLPD
                     IRNRFFHYNQENTPRMRLVAMLYTPLRANSGEDVFTVSCRVLTRPAPDFEFTFLVPPT
                     VESKTKPFTLPILTLGELSNSRFPAPIDMLYTDPNEGIVVQPQNGRCTLDGTLQGTTQ
                     LVPTQICAFRGTLIGQTSRSSDSTDSAPRRRDHPLHVQLKNLDGTQYDPTDEVPAVLG
                     AIDFKGTVFGVASQRDVSGQQVGATRAHEVHINTTDPRYTPKLGSILMHSESDDFVTG
                     QPVRFTPIGMGDNDWHQWELPDYSGHLTLNMNLAPAVAPAFPGERILFFRSMVPSAGG
                     YGSGQIDCLMPQEWVQHFYQEAAPSQSAVALIRYVNPDTGRNIFEAKLHREGFITVAN
                     SGNNPIVVPPNGYFRFEAWVNQFYTLTPMGTGQGRRRNQ"
     gene            6722..7501
                     /gene="VP2"
                     /locus_tag="T287_42397gpVP2"
     CDS             6722..7501
                     /gene="VP2"
                     /locus_tag="T287_42397gpVP2"
                     /note="minor capsid protein"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="AHI59155.1"
                     /translation="MASAFLAGLAGDVITNGVGSLINAGANAVNQKVEYDFNKQLQMA
                     SFKHDKEMLQSQVLATKQLQQEMMNIRQGVLTAGGFSPADAARGAVNAPMTKILDWNG
                     TRYWAPNSMKTTSYSGQFSSSPVHKSPAPSQHTALPKSRLQNDFASVYSFPSSVSSQS
                     THSTALSAGTGSSRSISPSTATPTLSRTSDWVRGQNERLSPFMDGALQTAFVTPPSSK
                     ASSNGTVSTVPKAVLDSWTPMFNTHRQPLFAHPRRRGESQV"
ORIGIN      
        1 gtgaatgaag atggcgtcta atgacgctac cactgccctt ggcagccaaa actctgtcaa
       61 tgacagtatc aacaccgccc cttctaataa agaagaggtt ggtgcattct ccaacatcaa
      121 agttggtttt aagaaaatac tgggtgccgt tcccaagggg actaaagcac ccagtagtga
      181 tcagcgctgc cccacagtta agatcgggac taaaacatta acagttcccc ctgagccccc
      241 aaatggtgaa gacgccgtgc agtttgacgc gaagtcggaa actgtgcgtg ggctaccaga
      301 cttgacaacg gtgcagaatg aacacgaaaa cacaccatac actgtccccc cattgagcga
      361 aagggagcac agaccagcca ctgagccgct tcctggcaca atactggaga tgtgggatgg
      421 tgaattctac cattactccg tgtacgtcag cggtggcaaa gccctagggg ttcacaagcc
      481 ccctgcagcg ataagcctcg cgacgataga gctcacaccc atatctcttt attggaggcc
      541 cgtttacacc cccaactatc tggtctgtcc agaaacgttg aaaggcctcg ctggtgagaa
      601 gttcccctac acggccttca gcaacaactg ttacaacttc tgttgctggg tgcttgagct
      661 caatgacacg tggcttagca ggaaaagcat ctccaggacc accggcttct tcaaaccata
      721 tcagtcttgg aataggagac ccctcccaac cgttgatgat ggaaagatca aaaaggtggc
      781 caacgcaatt ctctgcgcac ttggatcact gttttcaaaa ccaatcaagg acctactggg
      841 caaacttaaa ccattgaact tgctgcactt gctcgcatca tgtgactgga cgtttgcggg
      901 tatagtagag acagttatcc taatggcgga acttttcaac atcttttgga caccgccaga
      961 tgtttccagc ttcatagcct ccctgatagg tgactttgaa ttgcaagggc ctgaggacct
     1021 ggctgtggag cttgtccccg tggtcatggg tggcatagga atggttctcg gctttactgc
     1081 tgagaagata ggccgcatgc tgtcgtccgc tgcatcaaca ttgcgggcat gcaaagactt
     1141 ggggaattat gcccttgaca tattgaaact ggttatgaag tggttctttc caaagaaaga
     1201 agagaaagcc gagatggaaa ccctaagggc gatcgaggat gccgtcctgg acatggaagc
     1261 tataggaaac aaccatctca caaccctcct caaggacaag gatagcctca cggctttcat
     1321 gaagactctg gatctagaag aggagaaggc aaggaagctg tctaccaagt catcctcgcc
     1381 agacatcgtc ggcactatta acgccatact ggccagaata gctgctgcca ggtccctctt
     1441 acacaaggct aaagaagaaa tgttcagcag gatcagaccc gtggttgtta tgatctcggg
     1501 taggcctggc attggcaaaa cccacatggc aagacacttg gctaagagta tcgccaacac
     1561 catgagcggc gaccagagag tagggctcgt cccacgcaac ggggtcgatc attgggacgc
     1621 ctatagggga gagagggtgg tcttatggga tgattatggc atgggaaacc ctgtcaaaga
     1681 tgccctaaca ctgcaagagt tggctgacac ctgcccagta accctaaact gtgataggat
     1741 tgagaacaag gggaagatgt tcgacagtga tgtcatcata atcacgacca acttagtcaa
     1801 cccagcgccc ctcgattatg taaacttcga ggcgtgctcc agaagggtcg actttctggt
     1861 ctatgcagag tcaccagaaa ttgagaaggt taagagagac ttccccggcc aacctgacat
     1921 gtggaaggac cattttaagc cagacttttc ccacataaaa ttgactctag ccccacaggg
     1981 tggatttgac aaaaatggca ataccccgca tggcaagggc accatgcgat ccctaaccca
     2041 ggggtccctg actgcaaggg ttgcaggtct tgttcatgag aggagagacg agtttcagct
     2101 ccaggggaac gaccttcaaa catacaactt tgacaccaac agggtctctg catttaggaa
     2161 gctggccgca gacaacaagt atgggatcat ggagacaatg agagtgggca cggcgcttaa
     2221 gagtgtcaag accttggaag atctgaaagt tgccctgagg gatgtgaagt ttaatgagtg
     2281 tgagataatt tacaggaact ccaaataccg agtctcttcc aatggtaaag gttctgtctc
     2341 tgttgacaaa gtcgagggcc aaacatccca gactgcaaac gaagtgggtg cagcactcct
     2401 tagactcagg caggcaagag ccagatacta tgtcagctgc ttccaagatc tcgtctatac
     2461 tctaatacag gtcgccggag catcattcgt tgtcaacagg atctctaaaa ggttctgctg
     2521 ggagagatgg gtcaaaccaa ccgagaccca ggaaacgagt gaatccgaaa aggaagtagc
     2581 ccaaggcaga tgggagattg aacccaagga cacagaacca gaaggtaaga agggtaagaa
     2641 caagaaagga agaggcaaga aacacacagc tttctccagc aaaggcctga gtgatgagga
     2701 gtatgacgag ttcaagagaa tcagagaaga aaggagcgga aaatactcca ttgaggaata
     2761 cctgcaagac cgggatcgct actatgaaga agtggcagtt gcccgggcga cagaggagga
     2821 cttctgtgaa gaggaggagg ccaagataag acaaagaatc tttcgcccca caaagaaaca
     2881 gaggaaggaa gaaagagggg tgcttggttt ggtcactggc tcagacatca ggaagaggag
     2941 accagacgat ttccaaccga agggcaatct gtgggcagac gacaccagga gtgtggacta
     3001 caacgagaga cttgatttcg aggctccccc gagtgtctgg tcaagaatag tcccactggg
     3061 cactggctgg ggcttctggg tctcatccaa cctcctgatc acaacaacac acgtcctacc
     3121 taaggggatt aaggaacttt ttggagttga aatcaaacag attcaaatcc ataaatctgg
     3181 agagttctgc aggttcaggt tcccgagacc aatcagacca gatgtcacag ggctcgtgtt
     3241 ggaggaaggt gctccagaag gcactgtctg ctccgtactt gtaaagagac ctacaggtga
     3301 gatgatcccc ctggcagtga ggatgggcac gcatgcatcc atgaaaatac agggtaggac
     3361 tgtcggtggc cagatgggga tgctcctcac aggggcaaat gcgaagaaca tggatcttgg
     3421 caccggtcct ggtgactgcg gttgtcctta catctacaaa cgtggcaatg atatagttgt
     3481 cgcgggtgtc cacaccgcag cagcccgggg aggcaacact gtcatatgtg ccactcaagg
     3541 acaagatggg gaggcagtcc ttgagggaaa tgagaacctt ggcacttact gcggtgcccc
     3601 aattttgggt ccaggcaagg cgcccaaact tagcacgaag accaaattct ggcgttcatc
     3661 accagacgct ttgccgccag gcacttatga gcctgcctac ttgggaggca aggaccctag
     3721 agtggaaaaa ggaccatccc tgcagcaagt catgagggac cagctaaaac ctttcacaga
     3781 acccaggggc aagccaccta gacctgcagt cttagaagaa gccaaaaaga cagtgatgaa
     3841 tgttctagaa caaaccattg accctgctaa accatggacc tattcccaag catgtgcctc
     3901 actggacaag accacttcca gtggtagccc ccatcatgtc aggaaaaatg accattggaa
     3961 tggggaatcc ttcactggcc cccttgcaga ccaagcatcc aaagccaacc tcatgtacga
     4021 gcaggccaaa catgtgcagc ccgtgtacac ggccgcactc aaagatgagc tagtcaaaac
     4081 tgacaagatc tacaaaaaga taaagaaaag gctcttatgg gggtcggacc ttggtacaat
     4141 gattaggtgt gccagggcct ttggcggtct catggatagt atgaaggcaa gttgcatagc
     4201 ccttccatgt agggtaggaa tgaacatgaa tgaagatggt cccatcatat ttgacaaaca
     4261 ctctaagtat aggtaccatt atgatgctga ctattccagg tgggactcaa cccagcaaag
     4321 gagcattctc tcggccgcta tggaagtgat ggtgcggttc tctgccgaac cagagctggc
     4381 acaagtggtt gcagaggacc tcctggcacc tagccaacta gatgttggcg actttgtcat
     4441 ctcagtccag gagggtctgc catcgggggt cccatgcaca tcacaatgga attcaatagc
     4501 acactggatc ctaaccttga gtgcgatggc agaagtgtcg ggtctctcac cagatgttgt
     4561 tcaagcccat tcctgtttct cattctacgg tgatgatgag atcgtcagca ctgacatcaa
     4621 ccttgatccc atgaagttga cacagaaact cagagagtat ggtctggttc ccactcgacc
     4681 tgacaaaact gagggtcccc tcgtaataac tgaagatctc accggcctaa cgttcctgcg
     4741 taggtcaatt gcacgggacc cagctgggtg gtttggaaaa ttggaccaag actcaatcct
     4801 cagacagttg tactggacaa ggggccccaa tcatgagaac ccatatgaga gcatggttcc
     4861 tcattcccag cgggccacac agctcatggc ccttctcggt gaggcttcac tgcatggccc
     4921 ccagttttac aagaaggtta gcaagatggt catcaatgaa atcaaaagtg gtggtctgga
     4981 attctatgtg cccagacaag aggccatgtt cagatggatg agattctctg acctcagcac
     5041 atgggagggc gatcgcaatc ttgctcccga gggtgtgaat gaagatggcg tcgaatgacg
     5101 ctgctccatc gaatgatggt gctgccaacc tcgtaccaga ggccaacaat gaggttatgg
     5161 cacttgaacc ggtggtggga gcctcaatcg cagctcctgt cgtcggccaa caaaacataa
     5221 ttgacccctg gattagagaa aattttgtcc aagcaccaca gggcgagttc accgtttcac
     5281 cgaggaactc gcccggtgag atgctattaa atcttgaatt gggcccagag ctcaaccctt
     5341 acctaagtca cctgtcccgt atgtataatg ggtatgctgg tggcatgcag gttcaggtgg
     5401 tcctagctgg gaatgcgttc acagctggga aaatcatctt tgccgccgta ccaccacatt
     5461 ttcccgtaga aaacatcagt gcagctcaaa taactatgtg cccccatgta attgttgatg
     5521 tgagacaact tgaaccagta cttctgcccc ttcctgacat aaggaatagg ttctttcatt
     5581 acaaccagga gaacaccccc cggatgagac ttgtggctat gctttatacc cccctgaggg
     5641 ccaactctgg tgaagatgtg tttactgttt cttgcagggt cttgacccgt cctgcccctg
     5701 attttgaatt tactttcttg gtaccaccaa ctgttgagtc aaagactaaa cctttcacac
     5761 tgcccatatt aactcttggt gagctatcta attccagatt cccagcccca atagatatgt
     5821 tgtacactga cccaaatgag ggaattgtgg tccaaccaca aaatggtagg tgcactcttg
     5881 atggcactct gcaaggcacc acacaactgg tccccaccca aatttgtgct ttcaggggca
     5941 cactaattgg ccaaacatca agatcttcag actcaaccga ctcagcccct cggagaaggg
     6001 atcacccact ccatgtgcaa ttaaagaacc ttgatggcac gcagtacgac ccgactgatg
     6061 aagtgccagc agtccttggt gccattgact tcaaggggac tgtctttggg gtggccagtc
     6121 agagagatgt gtcagggcaa caagtgggag cgactcgagc tcatgaagtg cacatcaaca
     6181 caaccgatcc taggtacaca ccaaaactgg gatccattct catgcactca gagtcggacg
     6241 actttgtgac tggacagccg gtccgtttca cacccatagg aatgggtgac aacgactggc
     6301 accagtggga gctgcctgac tactctggac acctaaccct gaacatgaac cttgccccag
     6361 cagtcgctcc tgctttcccg ggcgagagga ttcttttctt caggtcaatg gtcccgtctg
     6421 ctggtggcta tgggtctgga caaatagatt gcctcatgcc acaggagtgg gttcagcatt
     6481 tctaccagga agctgcacca tcccaatctg ccgtggcact tattaggtat gtcaatcctg
     6541 acacaggcag aaacatcttt gaggctaaat tgcacaggga aggtttcatc accgtggcaa
     6601 attctggtaa caaccctatt gttgtccccc ctaatgggta ctttaggttt gaggcttggg
     6661 tgaatcaatt ttacactttg acccccatgg gaactggtca ggggcgtagg aggaatcaat
     6721 aatggctagt gcttttcttg caggtcttgc tggcgacgtc ataacaaatg gcgttggatc
     6781 tctaataaat gctggagcta atgcagtcaa tcagaaagtt gaatatgatt ttaataaaca
     6841 gcttcaaatg gcatcattta aacatgataa agagatgttg caatcacaag tgttggcaac
     6901 caagcagttg cagcaggaga tgatgaacat aaggcagggg gtgttgactg ctggcggctt
     6961 ctcccccgcg gatgctgcta gaggggccgt caatgcccca atgacaaaga ttctggactg
     7021 gaatggcacc aggtattggg caccaaatag catgaaaacc acaagttatt caggacagtt
     7081 ttctagcagc cctgttcaca agtcccctgc tccttctcag cacactgctt tgccaaagag
     7141 tagattgcaa aatgattttg ctagtgtata tagtttccct tcctctgttt cttcacaatc
     7201 aacccattca acagcgctgt cagcaggaac cgggtcttcc aggtccatct ccccatccac
     7261 agcgacccct accttgtcta gaaccagcga ctgggttagg ggacagaatg agaggctcag
     7321 cccgtttatg gatggtgctc tccaaactgc ctttgtcaca cctccatcga gcaaagcttc
     7381 ttcaaatggt acggtctcaa ccgttcccaa agctgttttg gactcctgga cccctatgtt
     7441 taacacacat aggcagcctc tcttcgccca cccacgtagg cgaggggagt cacaagttta
     7501 gtgaaaagag tgatcaggtt ttcttc
//