Typing tool

Complete norovirus genomes

KJ194504  GII.3
 GII.P3

Length: 7,535 | 3 CDS

ORF1: 5..5113
ORF2: 5094..6740
ORF3: 6740..7504
LOCUS       KJ194504                7535 bp    RNA     linear   VRL 08-APR-2014
DEFINITION  Norovirus Hu/GII/Amsterdam/1994 isolate NV_Amsterdam_1994, partial
            genome.
ACCESSION   KJ194504
VERSION     KJ194504.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII/Amsterdam/1994
  ORGANISM  Norovirus Hu/GII/Amsterdam/1994
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7535)
  AUTHORS   Cotten,M., Oude Munnink,B., Canuti,M., Deijs,M., Watson,S.J.,
            Kellam,P. and van der Hoek,L.
  TITLE     Full genome virus detection in fecal samples using sensitive
            nucleic acid preparation, deep sequencing, and a novel iterative
            sequence classification algorithm
  JOURNAL   PLoS ONE 9 (4), E93269 (2014)
   PUBMED   24695106
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 7535)
  AUTHORS   Cotten,M., Oude Munnink,B., Canuti,M., Deijs,M., Watson,S.J.,
            Kellam,P. and van der Hoek,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JAN-2014) Viral Genomics, Wellcome Trust Sanger
            Institute, Hinxton, Cambridgeshire CB10 1SA, United Kingdom
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: SPAdes v. 2.4.0
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7535
                     /organism="Norovirus Hu/GII/Amsterdam/1994"
                     /mol_type="genomic RNA"
                     /isolate="NV_Amsterdam_1994"
                     /host="Homo sapiens"
                     /db_xref="taxon:1472713"
                     /country="Netherlands"
                     /collection_date="30-Jan-1995"
                     /note="genotype: G2"
     CDS             5..5113
                     /codon_start=1
                     /product="ORF1"
                     /protein_id="AHV83698.1"
                     /translation="MKMASNDASVAVAGKNNNNDKEKSSGDSLFSNMTVSFKKALGAR
                     PKQPPPGEIKQTQKPPRPPTPELVKRIPPPPPNGEDEPKVVYRVGEGVSGLPDLTTVA
                     QPDAQGTAYSVPPLSQREVGEAKEPLPGSILEMWDGEIYHYGLYVDRGHILGVHKPPA
                     AVSLAKIELTPLSLYWRVVYTPQYLIAPDTLKGLNGESFPYTAFDNNCYAFCCWVLDL
                     NDSWLSRRMIRRTTGFFRPYQDWNRKPLPTMDEPKIKKAANAILCALSSLFTRPIKDI
                     IGKLKPMNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYEMQG
                     PEDLAMELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLKACKDLGAYGLEILKLVMKW
                     FFPKKEEANELALVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARK
                     LSTKSASPDIVGTINALLARIAAARSLVHKAKEELSSRQRPVVVMISGRPGIGKTHLA
                     RELAKKIASTLSGDQRIGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIQDALRLQELA
                     DTCPLTLNCDRIENKGKVFDSDVIILTTNLANPAPLDYVNFEACSRRIDFLVYADAPD
                     IEKAKRDFPGQPDMWKDHYRPDFTHIKLQLAPQGGFDKNGNTPHGKGVVKSLTLGSLI
                     ARASGLLHERMDEFELQGPNLPTFNFDRNKIAAFRQLAAENKYGMVDTLRVGNQLKSV
                     KTMDELKQAIKNITIKKCQIVYNGSTYTMESDGRGKVSVDKVQNATVQTNNELSGALH
                     HLRSARIRYYVKCFQEAVYSLLQIAGAAFVTSRIVRRMNISSLWSKPPVEESDESEDK
                     EGCPKPRDEDDLTIDSKDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIRDE
                     RNGKYSIEEYLQDRDRYYEELAIAKATEENFCEEEEIKIRQRIFRPTKKQRKEERATL
                     GLVTGSEIRKRNPDDFKPKGKLWADDSRSVDYNERIDFEAPPSVWSRIVNFGTGWGFW
                     VSPSLFITSTHVIPKGITEAFGVPMNQIQIHKSGEFCRLRFPKPIRPDVSGMILEEGA
                     PEGTVASILIKRTTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTT
                     PGDCGCPYVYKRGNDFVVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAP
                     ILGPGNAPKLSTKTKFWRSSNAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPF
                     TEPRGKPPNPSVLESAKKTIINVLEQVIDPPQKWSYAQACASLDKTTSSGNPHHVRKN
                     DYWNGESFTGKLADQASKANLMYEEGKHMPPVYTAALKDELVKTDKIYGKIKKRLLWG
                     SDLSTMIRCARAFGGLMDELKANCITLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYS
                     RWDSTQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKITINEGLPSGV
                     PCTSQWNSIAHWLLTLCALSEVTGLGPDIIQANSMYSFYGDDEIVSTDIKLDPEKLTA
                     KLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQLYWT
                     RGPNHEDPSETMIPHAQRPVQLMALLGESSLHGPSFYSKVSKLVISELKEGGMDFYVP
                     RQESMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5094..6740
                     /codon_start=1
                     /product="ORF2"
                     /protein_id="AHV83699.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEINNEAMALEPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKVIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPINLPMPD
                     VRNNFFHYNQGSDSRLRLVAMLYTPLRANNSGDDVFTVSCRVLTRPSPDFSFNFLVPP
                     TVESKTKPFTLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGTLTRSTSRASDQADTPTPRQFDHRWHIQLDNLNGTPYDPAEDIPAP
                     LGTPDFRGKVFGVASQRNPDGTTRAHEAKVDTTTNRFTPKLGSLEIITESEDFDTNQS
                     TKFTPVGVGVDNEEEFQQWSLPNYSGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GWSNGILDCLVPQEWVQHFYQESAPAQTQVALVRYVNPDTGRVLFEAKLHKLGFMTIA
                     KNGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRIQ"
     CDS             6740..7504
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="AHV83700.1"
                     /translation="MAGAFVAGLAGDMLTNTVGSLVNAGANAINQKVDFENNKYLQNA
                     SFNHDKEMLSAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPVTKVLDWSG
                     TRYWAPNAASTTSMSGGFTSQVVHRTTPNFKTSQAPKFTPSSGSSVRSSSTQLTNLSS
                     HSSGSSRSSGSTIVSSLPSSSRTRDWVNQQNLNLEPHMPGSLRTAFVTPPSSTASSSG
                     TVSTVPKNVLDSWTSAFNTRRQPLFAHLRRRGESNV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgttgccgtt gctggcaaaa acaacaacaa
       61 cgacaaggaa aaatcttcag gtgacagctt gttttctaac atgactgtct cctttaagaa
      121 agccctcggg gcgcggccta aacaaccgcc cccgggagaa ataaaacaaa cacaaaaacc
      181 accaagacca ccaacaccgg aactggtgaa aagaataccc ccaccaccac ccaatggcga
      241 ggatgaacca aaggtggtat acagggtggg agaaggtgtg tccgggctgc ccgacttaac
      301 aaccgtggcg cagcctgacg cacaaggcac agcttatagt gtacccccac ttagccaaag
      361 agaggtcggc gaagctaaag aaccgctacc tggatccatt ctggagatgt gggatggtga
      421 gatctaccac tatgggctgt acgttgatcg agggcacata cttggggtgc ataaaccacc
      481 tgctgcagta agcctcgcca aaattgaact gacaccactg tctctctact ggagagtggt
      541 ttacactccc cagtacttga tagccccaga cactctgaag ggtttgaatg gagagtcatt
      601 cccatacaca gcctttgaca acaactgtta cgccttctgt tgttgggtct tagatctcaa
      661 tgactcttgg cttagcagga gaatgattcg aaggacaacc ggtttcttca gaccgtacca
      721 agattggaat agaaaacccc tgccaaccat ggatgagcca aaaatcaaga aggccgcaaa
      781 tgctattctg tgcgctctct cctcactctt cactagaccc attaaggaca tcattgggaa
      841 gctcaaacca atgaacatcc tcaatatatt ggcaacttgt gactggactt ttgcaggcat
      901 agtggagtcc cttattcttc ttgctgaact ttttggggtg ttctggacac ccccagatgt
      961 gtctgcgatg attgctccct tactcggtga ctacgagatg caaggcccag aagacctggc
     1021 catggaactt gtacccgtgg taatgggagg gataggtttg gtgttgggat tcaccaagga
     1081 gaagatcggc aagatgcttt catcagctgc atccacgctt aaggcctgca aagatctagg
     1141 agcctatgga ttggagatac tcaaattggt catgaagtgg ttcttcccta agaaggaaga
     1201 ggctaacgag ttagccttgg taagggccat cgaggatgca gtcctggatt tagaagcaat
     1261 agaaaacaac cacatgacca ccctcctcaa ggacaaagac agtcttgcta catacatgag
     1321 gactcttgac ctagaggaag agaaagcaag aaaactgtcc accaaatccg catcacctga
     1381 cattgtgggc acaataaatg cattattggc aaggattgca gccgctaggt cattagtcca
     1441 caaggctaag gaggagctct caagcagaca gaggcctgtc gtcgtgatga tatctggcag
     1501 accaggcata gggaagaccc atctcgccag agagctagcc aagaaaattg catcaaccct
     1561 gtcgggtgac caaaggattg gactggtgcc tagaaacggt gtagaccact gggacgccta
     1621 caagggggaa agagtggtac tatgggatga ctatggcatg agcaacccca tacaggatgc
     1681 actgaggctt caagagttgg ctgatacctg tcctctaact ctaaactgtg acagaattga
     1741 aaacaaggga aaagtatttg acagtgatgt cataatctta acaaccaacc tcgcaaaccc
     1801 agcaccgctg gactatgtca actttgaggc ttgctccaga cgcatagact ttttagtgta
     1861 tgcagatgca cctgacattg agaaagccaa gcgtgacttt cccggccaac cagatatgtg
     1921 gaaagatcac tacagaccag actttacaca catcaaactt cagctagcac cacagggagg
     1981 ttttgataag aatggcaaca ccccacatgg taaaggtgta gtgaagtctc tgacgcttgg
     2041 gtcattgatc gccagggctt ccggtttgct tcacgagaga atggatgaat tcgagctcca
     2101 aggccctaac ctaccaacct tcaattttga ccgcaacaag atcgccgcct ttaggcaatt
     2161 ggcagctgaa aacaaatatg gtatggtgga cacactgagg gtcggtaatc aactgaagag
     2221 tgttaagacc atggatgagc tcaaacaggc tataaagaat atcaccatta aaaagtgcca
     2281 aatagtgtac aatgggtcta cctacacaat ggagtctgat ggaagaggca aggtttcagt
     2341 tgacaaggtg caaaacgcaa cggtccaaac taacaatgag ctttcaggag cgctgcacca
     2401 cttaagatct gcaagaataa gatattatgt taaatgtttc caggaagctg tctattcttt
     2461 actacaaatt gctggtgcgg cttttgtcac ctcacgcatt gtgaggcgca tgaacatctc
     2521 gagcctctgg tcgaagccac ctgttgaaga gagtgatgaa tctgaagaca aagaagggtg
     2581 ccccaagccc cgagatgaag atgacctcac tatcgattcc aaggacatta aagtggaagg
     2641 aaagaaaggc aagaacaagt ccggccgagg taagaaacac acagccttct catctaaggg
     2701 cctcagtgat gaagagtacg atgagtacaa gagaatcagg gacgaaagga atggcaaata
     2761 ttcaatagag gagtacctcc aagacaggga cagatactat gaagagctag ccattgctaa
     2821 ggccactgaa gagaacttct gtgaagagga ggagatcaag attcgtcaga gaatcttccg
     2881 ccccaccaaa aagcagcgga aagaggaaag agccacactt gggctcgtca cagggtcgga
     2941 gatcagaaag aggaatccag atgacttcaa gccaaaaggg aaactgtggg ctgatgatag
     3001 caggagtgtg gactacaatg agaggataga ttttgaagcg ccccctagcg tttggtcaag
     3061 gatagtcaac tttggcacag gctggggatt ctgggtttct ccaagtctct tcataacctc
     3121 gacacacgtg ataccaaaag gaatcacgga ggcatttggg gtgcccatga accaaatcca
     3181 aattcataaa tcaggggaat tctgccgctt gcggttccca aaaccaatca ggccagacgt
     3241 gagtgggatg attttggaag agggtgcccc tgaaggaact gttgcgtcca tcctcatcaa
     3301 aagaacaaca ggggagttga tgccccttgc agccagaatg ggaacccacg ccacaatgaa
     3361 aatccaagga agaacggtgg gtggccagat gggcatgtta ctcacaggtt caaatgccaa
     3421 aagcatggac ctaggcacaa caccaggtga ctgtgggtgc ccctacgtat acaagagggg
     3481 caatgacttt gtggtcattg gcgtgcacac tgcagcagca cgtggaggaa acacagtcat
     3541 atgtgccacg caaggaagcg aaggtgaagc cactcttgag ggaggtgacg acaagggcac
     3601 ctattgtgga gcccccattt taggacctgg taatgcacca aaattgagca caaaaacaaa
     3661 attctggaga tcatccaacg caccgctccc accaggcacc tatgaaccag catacctagg
     3721 tgggaaagat ccacgtgtga agggcggtcc gtctctgcaa caggtcatga gagaccaact
     3781 taaacctttc acagagccca gagggaaacc accaaacccg agtgtcctag aatcagcaaa
     3841 gaaaactatc atcaatgttc tagagcaggt cattgacccc ccccagaagt ggtcttatgc
     3901 ccaagcttgt gcatcccttg acaaaacaac ctccagtgga aacccgcacc acgttcggaa
     3961 aaatgattac tggaatggtg aatccttcac aggaaaactt gcagaccagg cttcaaaagc
     4021 aaatctcatg tatgaagaag gcaaacacat gccaccggtt tacaccgcag cgctcaagga
     4081 tgagctggtg aaaactgaca aaatctatgg caaaattaag aaaaggctcc tgtggggttc
     4141 tgacctctcc accatgattc ggtgcgccag agcatttggt ggactcatgg atgagctcaa
     4201 agcaaattgt atcacacttc ctgtcagagt tggcatgaac atgaatgaag atggtcccat
     4261 aatatttgag aaacattcca gatacagata ccactatgat gcagattact cccgctggga
     4321 ctccacgcag cagcgggcag tgttggcagc agcacttgaa atcatggtga ggttctctgc
     4381 tgaaccacag ctagcacaaa tagtggctga agacctgcta gcaccaagtg tggttgatgt
     4441 gggtgacttc aagatcacca ttaatgaagg cctaccttct ggtgtgcctt gcacctcaca
     4501 gtggaactcc attgcccact ggttgcttac tttgtgtgcc ctttctgagg tgacaggatt
     4561 aggccccgac atcatacaag ctaattccat gtactctttc tatggtgatg atgagattgt
     4621 gagcactgac attaaattgg acccagagaa actgactgca aaactcaaag agtacggcct
     4681 caaacccacc cggcccgaca agaccgaagg gccgctggtg atcagtgaag acttgaatgg
     4741 tttaacgttc ctccgtcgaa cagtcacccg tgacccagca ggttggtttg gaaaactgga
     4801 gcaaagttcc atcctcaggc agctatactg gacaagggga cctaaccatg aagaccccag
     4861 tgaaaccatg ataccacatg cgcagagacc cgtgcagctc atggcactac tgggagaatc
     4921 ctccctacat ggaccctcat tttacagcaa ggtcagcaag ctggttatat ctgaacttaa
     4981 ggagggagga atggattttt atgtgcccag acaagagtca atgttcaggt ggatgaggtt
     5041 ctcagatcta agcacatggg agggcgatcg caatctggct cccagttttg tgaatgaaga
     5101 tggcgtcgaa tgacgctgct ccatctaatg atggtgccgc cggcctcgtc ccagagatca
     5161 acaatgaggc aatggcgcta gagccagtgg cgggtgcagc gatagcagcg cccctcactg
     5221 gccagcaaaa tataattgat ccctggatta tgaataattt tgtgcaagca cctggtggtg
     5281 agtttacagt gtcacctagg aattcccctg gtgaagtgct tctcaatttg gaattaggcc
     5341 cagaaataaa tccctatttg gctcatcttg ctagaatgta caatggttat gcaggtggat
     5401 ttgaagtgca agtggtccta gctggaaatg cgtttacagc aggaaaggtt atctttgcag
     5461 ctataccccc taatttccct attgacaatc tgagcgcggc acagatcaca atgtgtccgc
     5521 acgtgattgt ggatgtcagg cagttggaac caatcaatct cccgatgcct gatgtccgca
     5581 acaatttctt tcattataat caaggttctg attcaagatt acgtttggtt gcaatgctgt
     5641 atacacctct tagggcaaat aattctggag atgatgtttt cactgtgtct tgtagggtgt
     5701 taactaggcc cagccctgat ttctcattca attttcttgt cccacccact gtggaatcaa
     5761 agacaaagcc ttttaccctc cccattttaa ccatctctga aatgtccaat tccaggtttc
     5821 cagttccaat tgactctctg cacaccagcc caactgagaa tatagttgtc cagtgccaaa
     5881 atgggcgcgt cactcttgac ggtgagttaa tgggcaccac ccaactctta ccgagccaaa
     5941 tatgtgcttt caggggcaca ctcactagat caacaagcag ggccagtgac caagccgaca
     6001 caccaacccc caggcaattc gaccatcgtt ggcacataca attggataat ctaaatggaa
     6061 ctccctacga ccctgcagag gacataccag ctcctttggg cacaccagac ttccggggta
     6121 aggtctttgg cgtggccagc cagagaaacc ccgacggcac aacaagggca catgaagcaa
     6181 aagtggacac aacaactaac cgcttcaccc caaaattggg ctccttagaa ataatcactg
     6241 aatctgaaga ctttgacaca aaccagtcaa caaaattcac cccagttggc gtcggagttg
     6301 acaatgagga agaattccaa caatggtcct tacccaacta ttctggtcag tttactcata
     6361 atatgaactt agccccagct gtcgccccca attttcctgg tgaacagcta cttttcttcc
     6421 ggtcacagct gccatcctct ggtgggtggt ctaacgggat tctagactgc ctggtccccc
     6481 aggaatgggt tcaacacttc taccaggaat cagcccccgc ccaaacgcag gtggccctgg
     6541 ttaggtatgt caaccctgac actggcagag tgctatttga ggccaagcta cacaaattgg
     6601 gttttatgac tatagcaaag aatggtgact ccccaataac tgtccctcca aatggatact
     6661 ttagatttga atcttgggtt aacccctttt atacacttgc ccccatggga actggaaacg
     6721 ggcgtagaag gattcaataa tggctggagc ttttgtagca ggattggctg gtgacatgct
     6781 cacaaacact gtagggtctt tggttaatgc aggggccaat gctattaatc aaaaagttga
     6841 ttttgaaaat aataaatatt tgcaaaatgc ttcttttaat catgataagg agatgttaag
     6901 tgcacaaatt gaggcaacaa agaggctgca ggctgacatg attgcaatca aacaaggggt
     6961 cttgaccgct ggcggctttt cccccactga tgcagcacgt ggggcaatta atgccccagt
     7021 gacaaaagtt ttagattgga gtggaacaag gtactgggca ccaaacgccg cctccacaac
     7081 ttcaatgtca ggtggcttca caagccaagt tgtgcacaga accacaccaa atttcaaaac
     7141 gagccaggcc cccaaattca cacccagcag tgggtcttca gtgagatcaa gctcaaccca
     7201 actcaccaac ttgagctcac actcatccgg gtcgtcccga tctagcgggt ctacgattgt
     7261 cagctcgctg ccgtcctcca gtaggactag ggactgggtc aaccaacaaa atctcaattt
     7321 ggaaccacac atgcctggat ctctcaggac agcttttgtc actccaccat ctagcacagc
     7381 ctctagttca ggcacagtct caaccgtgcc caaaaatgtt ttggactcct ggacatctgc
     7441 gtttaacacg cgcagacagc cgctgtttgc acaccttcgt agaagggggg agtcaaatgt
     7501 ttagtgaaaa gattattctt aaatttgatt ttgaa
//