Typing tool

Complete norovirus genomes

KF944111  GII.3
 GII.P16

Length: 7,554 | 3 CDS

ORF1: 4..5100
ORF2: 5081..6727
ORF3: 6727..7491
LOCUS       KF944111                7554 bp    RNA     linear   VRL 01-AUG-2019
DEFINITION  Norovirus GII isolate
            Hu/GII.P16-GII.3/Novosibirsk/Nsk-N1648/2011/RUS, complete genome.
ACCESSION   KF944111
VERSION     KF944111.3
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7554)
  AUTHORS   Zhirakovskaia,E.V., Tikunov,A.Y., Bodnev,S.A., Klemesheva,V.V.,
            Netesov,S.V. and Tikunova,N.V.
  TITLE     Molecular epidemiology of noroviruses associated with sporadic
            gastroenteritis in children in Novosibirsk, Russia, 2003-2012
  JOURNAL   J. Med. Virol. 87 (5), 740-753 (2015)
   PUBMED   25693507
REFERENCE   2  (bases 1 to 7554)
  AUTHORS   Zhirakovskaia,E., Tikunov,A., Tymentsev,A., Sokolov,S.,
            Sedelnikova,D. and Tikunova,N.
  TITLE     Changing pattern of prevalence and genetic diversity of rotavirus,
            norovirus, astrovirus, and bocavirus associated with childhood
            diarrhea in Asian Russia, 2009-2012
  JOURNAL   Infect. Genet. Evol. 67, 167-182 (2019)
   PUBMED   30414977
REFERENCE   3  (bases 1 to 7554)
  AUTHORS   Zhirakovskaya,E. and Tikunova,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-DEC-2013) Siberian Branch of Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine,
            Lavrentiev Ave. 8, Novosibirsk 630090, Russia
REFERENCE   4  (bases 1 to 7554)
  AUTHORS   Zhirakovskaya,E., Tikunov,A. and Shlyakhtun,V.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-SEP-2015) Siberian Branch of Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine,
            Lavrentiev Ave. 8, Novosibirsk 630090, Russia
  REMARK    Sequence update by submitter
COMMENT     On Sep 17, 2015 this sequence version replaced KF944111.2.
            
            ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7554
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.P16-GII.3/Novosibirsk/Nsk-N1648/2011/RUS"
                     /isolation_source="fecal sample"
                     /host="Homo sapiens; sex: M; age: 4 months"
                     /db_xref="taxon:122929"
                     /country="Russia: Novosibirsk"
                     /collection_date="07-Feb-2011"
                     /note="genotype: GII.P16-GII.3"
     gene            4..5100
                     /gene="POL"
     CDS             4..5100
                     /gene="POL"
                     /note="ORF1; encodes p48, NTPase, p22, VPg, 3CLpro, RdRp"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ALE30633.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDNSQKPPRPPTPELVKRIPPPPSNGEEEEPVIRYEVKSGVSGLPELTTVPQP
                     DVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAV
                     SMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLND
                     SWLNRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLIG
                     KIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLARE
                     VARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADT
                     CPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVE
                     KAKRDFPGQPDMWKDAFKSDFSHIRLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERMDEFELQGPTVTTFNFDRNRITAFRQLAAENKYGLVDTMRVGNQLKGVKT
                     MEELKQAIKNVIIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHHL
                     KHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPPLDQNESEAKEEA
                     PKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEELAIAKATEEDFCEEEEVKIRQRIFRPTRKQRKEERATLGLVT
                     GSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPS
                     LFITSTHVIPAGITEAFGVPIKQIQVHKSGEFCRFRFPKPIRPDVTGMILEEGAPEGT
                     VATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDC
                     GCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGP
                     GGAPKLSTKTKFWRSSNMPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGYPHHVRKNEFWN
                     GETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKVYGKIKKRLLWGSDLS
                     TMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTKLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLKE
                     YGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGPN
                     HEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     gene            5081..6727
                     /gene="VP1"
     CDS             5081..6727
                     /gene="VP1"
                     /note="major capsid protein; ORF2"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="AIS24557.2"
                     /translation="MKMASNDAAPSNDGAAGLVPEINNEAMALDPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKVIFAAIPPNFPTDNLSAAQITMCPHVIVDVRQLEPINLPMPD
                     VRNNFFHYNQGSDSRLRLIAMLYTPLRANNSGDDVFTVSCRVLTRPSPDFSFNFLVPP
                     TVESKTKPFTLPILTISEMSNSRFPVPIDSLHTSPTDNIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGVLTRSTSRASDQADAATPRLFNYYWHIQLDNLNGTPYDPAEDIPAP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKVDTTSGRFTPKLGSLEISTESGDFDQNQP
                     TRFTPVGIGVDNEADFQQWTLPDYSGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPAQTQVALVRYVNPDTGRVLFEAKLHKLGYMTIA
                     KSGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRIQ"
     gene            6727..7491
                     /gene="VP2"
     CDS             6727..7491
                     /gene="VP2"
                     /note="minor capsid protein; ORF2"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="ALE30634.1"
                     /translation="MAGAFIAGLAGDMLTNTVGSLVNAGAGAINQKVDFENNKYLQNA
                     SFNHDKEMLNAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPITKVLDWSG
                     TRYWAPNATSTTSMSGGFTGQAVHRATPNFKTNQAPKSTPSSGSSVRSSSTQLTNLSS
                     HSSGSSRSSGSTMVSSLPSSSRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSLD
                     TVSTVPKSVLDSWTPAFNTRRQPLFAHLRRRGESNI"
ORIGIN      
        1 tgaatgaaga tggcgtctaa cgacgctacc gttgccgttg cttgcaacaa caacaacgac
       61 aaggaaaaat cttcaggtga aggcttattc acaaatatgt cttccacctt aaagaaagcc
      121 ctcggggccc ggcccaaaca gcctgccccg agggacaact cacaaaagcc cccaagacca
      181 ccaactcccg agttggttaa gaggataccc cctcccccat ctaatggtga agaagaagaa
      241 ccagtcatta ggtatgaggt taagagtggg gtctctggcc tgcccgagct cacaacagtc
      301 ccccaaccgg atgtggccaa cacggcattc agtgtcccac cgctaagcct gagagaaaac
      361 agggaggcca aggaaccgct gacaggggca atattagaga tgtgggatgg agagatatat
      421 cactatggcc tgtacgtgga gaaaggctta gtgttgggtg tgcacaaacc acctgcagct
      481 gtaagcatgg caaaagtgga gctgacgcct ttgtcattgt actggcgtgt ggtctacacc
      541 ccccaatacc tcatctcccc tgaaactctc aggaggctca acggagaggc attcccttac
      601 accgcctttg acaacaactg ctatgccttt tgctgctggg tattagacct caatgattca
      661 tggcttaaca ggaggatggt gcaaagaaca acaggcttct tcagacctta ccaagagtgg
      721 aacagaaaac ccctgcctac tatggatgac tccaaaatca agaaggtggc aaacatattc
      781 ctgtgttcat tgtccacgtt gttcaccaga cctataaaag acctcatagg aaaaattaaa
      841 ccattaaata tcttgaacat cctggcaacg tgtgactgga cattcgccgg aatagtggag
      901 tctctgatat tactcgctga actctttgga gttttctgga cacccccaga tgtgtctgct
      961 atgatcgctc ccttacttgg agactacgag ttgcaagggc cagaagacct cgccgttgag
     1021 ctcgtgcctg tggtgatggg agggattggt ctggtgttgg gattcaccaa agagaaaatt
     1081 ggcaaaatgt tgtcctcagc agcatcaacg ctcagggctt gtaaggatct tggtgcctat
     1141 ggcttagaga tactcaaatt ggtcatgaag tggttcttcc caaagaaaga agaggccaat
     1201 gagctagcca tggtgagagc tatagaggat gctgtactgg atcttgaggc aatagaaaac
     1261 aatcacatga caactttgct gaaagacaaa gacagcctag caacctacat gaaaacactg
     1321 gacatggagg aggaaaaagc cagaagattg tccacaaaat ctgcatcccc cgacatagtt
     1381 gggacgatca acgccctgct ggctcgaata gcagcggcta ggtcactagt ccacagggcc
     1441 aaggaggagt tatctagcag gataagacca gtagttgtca tgatatctgg caaaccaggg
     1501 ataggaaaaa ctcatttggc cagggaggtg gcaagaaagg tggcatccac tctcacaggg
     1561 gatcaaagag tcgggctcat accgagaaat ggtgtggacc attgggatgc atataaaggt
     1621 gagagagtcg tgctgtggga cgactatggc atgagcaacc ccattcatga tgctctgcgc
     1681 atacaagaat tggctgatac gtgtcccctt accttaaatt gtgacagaat tgaaaataag
     1741 ggaaaagttt ttgacagtga agtcataata attacaacaa accttgccaa tccagcccca
     1801 cttgattatg tcaactttga ggcctgctcc aggagaattg acttcctggt ttacgccgag
     1861 gcaccagaag tagaaaaggc aaaacgagac tttcctggtc aaccagatat gtggaaggac
     1921 gccttcaagt cggacttttc acatatcagg ttgcaacttg cacctcaggg cggctttgac
     1981 aagaatggca acaccccaca tggaaaagga gtgatgaaga ccctcaccac cggttccctg
     2041 attgcccgtg catcaggctt actgcatgag aggatggatg aatttgaact ccaaggcccc
     2101 acagtcacca ccttcaattt cgaccggaac agaatcaccg cattcagaca attggctgca
     2161 gaaaataagt atgggttggt ggacaccatg agagttggca atcaattaaa aggggtgaaa
     2221 accatggaag aactcaaaca agcaatcaaa aatgtgatca tcaagaggtg ccggatcatc
     2281 tacggtggct ccacgtatga ccttgaatct gatggcaagg gcaaagtttt ggtggaaaag
     2341 gtcaagaaca cctctgtaca gaccaacaac gagttggccg gagccctgca tcacctcaaa
     2401 catgcccgga tcaggtacta tgtcaaatgt gtgcaagaag cagtctactc tatcatacaa
     2461 attgccggcg ctgcatttgt caccacacgc attgcacgcc gcatgaacat acaagagctt
     2521 tggtcgaagc caccattaga ccaaaatgaa tcagaggcta aggaagaggc ccccaagtca
     2581 gaagatgacg agttcatcat atcttctaag gacatcaagg aggaaggaaa gaagggcaaa
     2641 aacaaaactg gccgtggcaa gaaacacact gcattctcta gcaagggctt gagcgatgag
     2701 gagtatgacg agtacaagag gataagagaa gagagaaatg ggaagtactc tatagaggag
     2761 tatcttcaag acagagacag gtactatgag gaactcgcca tcgccaaggc cacggaagaa
     2821 gacttctgtg aggaggagga ggtcaaaatc cgtcagagga tcttccgtcc caccaggaaa
     2881 caaaggaagg aagagagggc cacactaggg ctagtaactg gttcagaaat cagaaaaaga
     2941 aaccctgatg acttcaaacc taaagggaaa ctgtgggccg atgacaacag aagtgttgac
     3001 tacaatgaga aactggactt tgaggccccc ccaagcatat ggtctaggat tgtgagcttt
     3061 ggttctggct ggggcttctg ggtatcacca agcctgttca taacatcaac tcatgtaatt
     3121 cctgcaggca taacagaggc atttggagtc cccatcaaac aaatccaggt ccacaaatca
     3181 ggtgaatttt gccggttcag attcccaaaa ccaattaggc cagatgtgac aggaatgatc
     3241 ttggaagaag gtgcgcctga gggtaccgtg gcaaccgtgc tcatcaaacg ccctaccgga
     3301 gagctcatgc cccttgcagc cagaatgggg acacacgcaa ccatgaaaat tcaaggccgc
     3361 atggttggcg gacagatggg tatgttgctc actggttcaa atgctaaagg aatggatttg
     3421 ggaacaactc ctggtgattg tggctgtccc tacatctaca aaaggggcaa tgactatata
     3481 gtcattgggg tgcacacagc agcagcccgt ggtggaaaca ccgtcatctg tgccacacag
     3541 ggaagtgagg gtgaggcaac tcttgagggt ggagatgaca aaggaacata ctgtggggca
     3601 cccattcttg gccctggagg ggcaccaaaa ttgagcacca aaaccaaatt ttggaggtca
     3661 tcgaacatgc ctcttccacc agggacatat gagcctgcct acctcggtgg ccgtgacccg
     3721 cgtgttaagg gtgggccctc cttgcagcag gtaatgagag accagttgaa gccattcact
     3781 gagcccaggg gcaaacctcc aagaccaagt gtgttggaag cagccaaaca aaccatcatc
     3841 aatgtcctcg aacaaaccct ggaccctcca caaaaatgga catacgcaca ggcgtgtgct
     3901 tcacttgaca aaaccacctc cagcgggtat ccccaccacg tccgaaagaa tgaattctgg
     3961 aatggtgaga ccttcactgg taagttggca gaccaagcat caaaagcaaa cctaatgttt
     4021 gaggaaggga aacacatgac accagtgtat acagcagccc tcaaggacga gctggtcaag
     4081 actgacaaag tctatggaaa gatcaagaag agactgctct ggggctctga tttgtccacc
     4141 atgatccggt gcgccaggtc ctttggtggg ctcatggatg agatgaaggc acactgcata
     4201 tcactcccag tccgagttgg catgaacatg aatgaagatg gtccaataat atttgagaag
     4261 cactccagat acaagtacca ctatgatgca gactactccc gctgggattc aacacaacag
     4321 agggcagtat tagcagcagc cttggaaatc atggtcaggt tctctgcaga gccacaattg
     4381 gcacagatag tcgctgagga tctgttggcc cccagtgtgg tagatgtagg agactttaaa
     4441 atttcaataa atgaagggct cccctctggt gtgccatgca cttctcagtg gaattccatc
     4501 gcacactggc tgctaaccct ctgtgccttg tctgaagtca ccaaactgtc ccctgacatt
     4561 gtacaggcaa attccatgtt ctcattttac ggtgatgacg agattgtcag caccgatata
     4621 aaattggacc ctgaaaagtt aaccaccaaa ttgaaggagt acggcctgaa accaactcgc
     4681 ccagacaaaa ccgagggacc cctgatcatc agtgaggatt tgaacggact cactttcctt
     4741 cggaggacgg tgactcgtga cccagctggc tggtttggaa aattggacca aagttcaata
     4801 ttgaggcaga tgtactggac tagaggacca aatcatgaag accccaatga gacaatgata
     4861 ccccactctc aaagacccat acagctcatg gcactgcttg gtgaggcctc ccttcacgga
     4921 ccctctttct acagcaaaat tagtaaattg gtcataactg aactcaaaga aggtgggatg
     4981 gatttttacg tgccaaggca ggaacccatg ttcaggtgga tgaggttttc tgacttgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc aattttgtga atgaagatgg cgtcgaatga
     5101 cgctgctcca tctaatgatg gtgccgccgg cctcgtacca gagatcaata atgaggcaat
     5161 ggcgctagat ccagtggcgg gcgcagcgat agcagcaccc cttactggtc agcaaaacat
     5221 aatagatccc tggattatga ataattttgt gcaagcacct ggtggtgagt ttacagtgtc
     5281 acctaggaac tcccctggtg aagtacttct aaatttagaa ttaggcccag aaataaatcc
     5341 ctatctggcg catcttgcta ggatgtacaa tggttatgca ggtgggtttg aggtgcaggt
     5401 ggtcctggct ggaaatgcgt ttacagcagg gaaagtgatc tttgcagcta taccccccaa
     5461 tttcccaact gacaatttga gtgcagcgca gattacaatg tgtcctcatg taattgtaga
     5521 tgtcaggcag ttggaaccaa tcaacctccc gatgcctgat gtccgcaaca atttcttcca
     5581 ttataatcaa ggttctgatt cgaggttacg cttaattgca atgttgtaca ctccccttag
     5641 ggcaaataat tctggggatg atgttttcac tgtgtcatgt agggtgttga ctaggcccag
     5701 tcctgacttc tcattcaatt tcctcgtccc gcccactgtg gaatcaaaga caaaaccttt
     5761 caccctccct attttgacca tctctgagat gtctaattct agatttccag tgccaattga
     5821 ctctctgcac accagtccaa ctgataacat tgttgtccag tgccaaaatg ggcgcgtcac
     5881 ccttgatggc gagctaatgg gcaccaccca actcttgccg agtcagatat gtgcttttag
     5941 gggtgtgctc accagatcaa caagcagggc cagtgatcaa gctgacgcag caacccctag
     6001 actcttcaac tactattggc acatacaact agacaaccta aatgggaccc cgtatgaccc
     6061 tgcagaggac ataccagctc ctctggggac gccagacttt cggggcaaag tctttggcgt
     6121 agccagccag agaaaccctg acagcacaac aagggcacat gaggcaaaag tggatacaac
     6181 atctggccgc ttcaccccaa aattgggctc cctagaaata tccactgaat ctggtgactt
     6241 tgaccagaat caaccaacaa gattcacccc agttggcatt ggagttgaca atgaggcaga
     6301 ctttcaacaa tggaccttac ccgattattc cggtcagttc acccacaaca tgaatctggc
     6361 cccagctgtc gctcccaatt ttcccggtga acagcttctt ttcttccgct cacagttgcc
     6421 atcctctggc gggcggtcca atggcattct agactgcctg gtcccccagg aatgggtcca
     6481 acacttctac caggaatccg cccctgccca aacgcaggtg gctctggtca ggtatgtcaa
     6541 ccctgatact ggtagggtgt tatttgaggc taagctgcat aagctaggct acatgaccat
     6601 agctaagagt ggtgattctc caataactgt acccccaaat ggatacttta ggtttgaatc
     6661 ttgggtgaat cccttttaca cattagcccc catgggaact gggaatgggc gtagaaggat
     6721 tcaataatgg ctggagcctt tatagcagga ttggctggtg acatgctcac aaacactgta
     6781 gggtctttag ttaatgcagg ggctggtgct attaatcaaa aagttgattt tgaaaataat
     6841 aaatatctac aaaatgcatc ctttaatcat gataaggaga tgttaaatgc acaaattgag
     6901 gcaactaaga ggctacaggc tgacatgatt gctatcaaac aaggggtttt gaccgctggc
     6961 ggtttctccc ccactgatgc agcccgtggg gctattaacg cccccataac aaaagttctg
     7021 gactggagtg gaaccaggta ctgggcacca aatgccacct ccacaacttc aatgtcaggt
     7081 ggcttcacag gtcaagctgt gcatagagct acaccaaatt ttaaaaccaa ccaagcccca
     7141 aaatccacac ccagcagtgg gtcttcagtg aggtcaagct caacccaact caccaacttg
     7201 agctcacact catctgggtc ttctcgatcc agcggatcca cgatggtcag ctcgttacca
     7261 tcttccagca ggactagaga ctgggttaac caacagaatt ttaatttgga accacacatg
     7321 cctggatctc ttaggacagc ttttgttact ccaccatcta gtacagcctc tagcttagac
     7381 acggtctcaa ccgtgcccaa gagtgttttg gactcctgga cacctgcgtt taacacgcgc
     7441 agacagccgc tcttcgcaca ccttcgtaga aggggggagt caaatattta gtgaaaagat
     7501 tattcttaaa tttggtttgt aattggattt aaattagaat cttttaaaaa aaaa
//