Typing tool

Complete norovirus genomes

KF920739  GII.16
 GII.P16

Length: 7,580 | 3 CDS

ORF1: 5..5101
ORF2: 5082..6704
ORF3: 6704..7501
LOCUS       KF920739                7580 bp    RNA     linear   VRL 22-APR-2019
DEFINITION  Norovirus GII strain
            Hu/GII.P16-GII.16/RUS/Novosibirsk/Nsk-N4740/2012, complete genome.
ACCESSION   KF920739
VERSION     KF920739.4
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7580)
  AUTHORS   Zhirakovskaia,E.V., Tikunov,A.Y., Bodnev,S.A., Klemesheva,V.V.,
            Netesov,S.V. and Tikunova,N.V.
  TITLE     Molecular epidemiology of noroviruses associated with sporadic
            gastroenteritis in children in Novosibirsk, Russia, 2003-2012
  JOURNAL   J. Med. Virol. 87 (5), 740-753 (2015)
   PUBMED   25693507
REFERENCE   2  (bases 1 to 7580)
  AUTHORS   Zhirakovskaia,E., Tikunov,A., Tymentsev,A., Sokolov,S.,
            Sedelnikova,D. and Tikunova,N.
  TITLE     Changing pattern of prevalence and genetic diversity of rotavirus,
            norovirus, astrovirus, and bocavirus associated with childhood
            diarrhea in Asian Russia, 2009-2012
  JOURNAL   Infect. Genet. Evol. 67, 167-182 (2019)
   PUBMED   30414977
REFERENCE   3  (bases 1 to 7580)
  AUTHORS   Zhirakovskaya,E. and Tikunova,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-NOV-2013) Siberian Branch of Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine,
            Lavrentiev Ave. 8, Novosibirsk 630090, Russia
REFERENCE   4  (bases 1 to 7580)
  AUTHORS   Zhirakovskaya,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2018) Siberian Branch of Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine,
            Lavrentiev Ave. 8, Novosibirsk 630090, Russia
  REMARK    Sequence update by submitter
COMMENT     On Apr 22, 2019 this sequence version replaced KF920739.3.
FEATURES             Location/Qualifiers
     source          1..7580
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.P16-GII.16/RUS/Novosibirsk/Nsk-N4740/2012"
                     /isolate="Hu/GII.16/Novosibirsk/Nsk-N4740/2012/RUS"
                     /isolation_source="feces"
                     /host="Homo sapiens; sex: M; age: 4 months"
                     /db_xref="taxon:122929"
                     /country="Russia: Novosibirsk"
                     /collection_date="22-Aug-2012"
                     /note="genotype: GII.P16/GII.16"
     5'UTR           1..4
     gene            5..5101
                     /gene="ORF1"
     CDS             5..5101
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AZL94863.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDNSQRPPRPPTPELVKRVPPPPPNGEEEEPVIRYEVKSGISGLPELTTVPQP
                     DVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAI
                     SMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLND
                     SWLNRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLIG
                     KIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLARE
                     VARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADT
                     CPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVE
                     KAKRDFPGQPDMWKDAFKSDFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERMDEFELQGPTVTTFNFDRNRITAFRQLAAENKYGLVDTMRVGNQLKGVKT
                     MEELKQAIKNVIIKRCRIIYGGSTYDLESDGKGKVLVEKVKNTSVQTNNELAGALHHL
                     KHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPSLDQNESEAKEEV
                     PKPEDDEFIISSRDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEELAIAKATEEDFCEEEEVKIRQRIFRPTRKQRKEERATLGLVT
                     GSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPS
                     LFITSTHVIPAGITEAFGVSIKQIQVHKSGEFCRFRFPKPIRPDVTGMILEEGAPEGT
                     VATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDC
                     GCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGP
                     GGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPKPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFWN
                     GETFTGKLADQASRANLMFEEGKHMTPVYTAALKDELVKTDKVYGKIKKRLLWGSDLS
                     TMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTKLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLKE
                     YGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGPN
                     HEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKVSKLVITELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     mat_peptide     5..997
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     998..2095
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2096..2626
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2627..3025
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3026..3568
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3569..5098
                     /gene="ORF1"
                     /product="RNA-dependent RNA polymerase"
     gene            5082..6704
                     /gene="ORF2"
     CDS             5082..6704
                     /gene="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="AZL94862.2"
                     /translation="MKMASSDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRLNFVQAPNGEFTVSPRNSPGEILLNLELGPELNPYLAHLARMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAVPPHFPVDNLSPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQNESRMRLIAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFSVPVLTLNELTNSRFPVPIDAMYTSPNDTIVVQPQNGRATIDGELLGTT
                     QLIPSGICSFRGRITAHLQDDSHLWSVQVTNLNGTPFDPTDDVPAPLGMPDFSGQIFG
                     VISQRDTGSNNPANRSHDAVVPTYSPKFTPKLGSIQIGTWDTNDLQNQPVKFTPVGLN
                     EIGDDKHFDQWVLPNYSGALGLNMHLAPAVSPLFPGERLLFFRSYIPLKGGHGNPYID
                     CLVPQEWIQHFYQESAPAQSSVALLRYVNPDTGRTLFEAKLHKEGFITVASTENRPVV
                     VPPNGYFRFDSWVNQFYSLAPMGTGNGRRRMQ"
     gene            6704..7501
                     /gene="ORF3"
     CDS             6704..7501
                     /gene="ORF3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QCD16859.1"
                     /translation="MAGAFIAGLAGDIVTNSVGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQIQATKQLQADMISIRQGVLTAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRYWAPGASRTTSFSGGFTNTTRARTVEPPKSSPPAHNTLASVPRSSSTVSSSSTRST
                     VITSSSAAPSTRSSITRNSPRNTSQSVSSVSSRTSDWVQNQNRMLEPYLRGSLQTAFV
                     SPSSSKASSNGTVSTVPKEILDSWTSAFNTRRQPLFAHLRRRGESQA"
     3'UTR           7502..7580
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcaggtg aaggcttatt cacaaatatg tcttccacct taaagaaagc
      121 cctcggggcc cggcccaaac agcctgcccc gagggacaac tcacaaaggc ccccaagacc
      181 accaactccc gagttggtta agagggtacc ccctccccca cctaatggtg aagaagaaga
      241 gccagtcatt aggtatgagg ttaagagtgg gatctctggc ctgcccgagc tcacaacagt
      301 tccccaaccg gatgtggcca acacggcatt cagtgtcccg ccgctgagct tgagagaaaa
      361 cagggaggcc aaggaaccgc tgacaggggc aatattagag atgtgggatg gagagatata
      421 ccactatggc ctgtacgtgg agaaaggctt agtgttgggt gtgcacaaac cacctgcagc
      481 tataagcatg gcaaaagtgg agctgacgcc gttgtcattg tactggcgtg tggtctacac
      541 cccccaatac ctcatctccc ctgaaactct caggaggctc aacggagagg cattccctta
      601 caccgccttt gacaacaact gctatgcctt ttgctgctgg gtattagacc tcaatgactc
      661 atggcttaac aggaggatgg tgcaaagaac aacaggcttc ttcagacctt accaagagtg
      721 gaacagaaag cccctgccca ctatggatga ctccaaaatc aagaaggtgg caaacatatt
      781 cctgtgttca ttgtccacgt tgttcaccag acctataaaa gacctcatag gaaaaattaa
      841 accattaaac atcttgaaca tcctggcaac gtgtgactgg acattcgccg gaatagtgga
      901 gtctctgata ttacttgctg aactctttgg agttttctgg acacccccag atgtgtctgc
      961 tatgatcgct cccttacttg gagactacga gctgcaaggg ccagaagacc tcgccgttga
     1021 gctcgtacct gtggtaatgg gagggattgg tttggtgttg ggattcacca aagagaaaat
     1081 tggcaaaatg ttgtcctcag cagcatcaac gctcagggct tgtaaagatc ttggtgccta
     1141 tggcttagag atactcaaat tggtcatgaa gtggttcttc ccaaagaaag aagaggccaa
     1201 tgagctagcc atggtgagag ctatagagga tgctgttctg gatcttgagg caatagaaaa
     1261 taatcacatg acaactctgt tgaaagacaa agacagccta gcaacctaca tgaaaacact
     1321 agacatggag gaggagaaag ccagaagatt gtccacaaaa tctgcatccc ctgacatagt
     1381 tgggacgatc aacgccctgc tggctcgaat agcagcggct aggtcactag tccacagggc
     1441 caaggaagag ttatctagca ggataagacc agtagttgtt atgatatctg gcaaaccagg
     1501 gataggcaaa actcatttgg ccagggaggt ggcaagaaaa gtggcatcca ctctcacagg
     1561 ggatcaaaga gtcgggctca taccaagaaa cggtgtggac cattgggatg catacaaagg
     1621 tgagagggtc gtgctgtggg atgactatgg catgagcaac cccattcatg atgctctgcg
     1681 catacaagaa ttggctgaca cgtgtcccct taccttaaat tgtgacagaa ttgaaaataa
     1741 gggaaaagtt tttgacagtg aagtcataat aattacaaca aaccttgcca atccagctcc
     1801 acttgattat gtcaactttg aggcctgttc caggagaatt gacttcctgg tgtatgccga
     1861 tgcaccagaa gtagaaaagg caaaacgaga ctttcctggt caaccagata tgtggaagga
     1921 cgccttcaag tcggactttt cacatatcaa gttgcaactt gcacctcagg gcggctttga
     1981 caagaatggc aacaccccac atgggaaagg agtgatgaag accctcacca ctggttccct
     2041 gattgcccgt gcatcaggct tattgcatga gaggatggat gaatttgaac tccaaggccc
     2101 cacagtcacc accttcaatt tcgaccgtaa cagaatcacc gcattcagac aattggctgc
     2161 agaaaacaag tatgggttgg tggacaccat gagagttggc aatcaattaa aaggggtgaa
     2221 aaccatggaa gaactcaaac aagcaatcaa gaatgtgatc atcaagaggt gccggatcat
     2281 ctacggtggc tccacgtatg accttgaatc tgatggcaag ggcaaagttt tggtggaaaa
     2341 ggtcaagaat acctctgtgc agaccaacaa cgagttggcc ggagccctgc atcacctcaa
     2401 acatgcccga atcaggtact atgtcaagtg tgtgcaagaa gcagtctact ctatcataca
     2461 aattgccggc gctgcgtttg tcaccacacg cattgcacgc cgcatgaaca tacaagagct
     2521 ttggtcgaag ccatcattag accaaaatga atcagaggct aaggaagagg tccccaagcc
     2581 agaagatgac gagttcatca tatcttctag ggacatcaag gaggaaggaa agaagggcaa
     2641 aaacaaaact ggccgtggca agaaacacac tgcattctct agcaagggct tgagcgatga
     2701 ggaatatgat gagtacaaga ggataagaga agagagaaac gggaagtact ctatagagga
     2761 gtatcttcaa gacagagaca ggtactatga ggaactcgcc atcgccaagg ccacggaaga
     2821 agacttctgt gaggaagagg aggtcaaaat ccgtcagaga atcttccgtc ccaccaggaa
     2881 acaaaggaag gaagagaggg ccacactggg gctagtaact ggttcagaaa tcagaaaaag
     2941 aaaccctgat gacttcaaac ctaaagggaa actgtgggcc gatgacaaca gaagtgttga
     3001 ctacaatgag aaattggact ttgaggcccc cccaagcata tggtctagga ttgtgagttt
     3061 tggttctggt tggggcttct gggtatcacc aagcctgttc ataacatcaa ctcatgtaat
     3121 ccctgcaggc ataacagagg catttggagt ctccatcaaa caaatccagg tccacaaatc
     3181 aggtgaattt tgccggttca gattcccaaa accaattaga ccagatgtga caggaatgat
     3241 cttggaagaa ggtgcgcctg agggcaccgt ggcaaccgtg ctcatcaaac gccctaccgg
     3301 agagctcatg ccccttgcag ccagaatggg gacacacgca accatgaaaa ttcaaggccg
     3361 catggttggc ggacagatgg gtatgttgct cactggttca aatgctaaag gaatggattt
     3421 gggaactact cctggtgatt gtggctgtcc ctacatctac aaaaggggca atgactatat
     3481 agtcattggg gtgcacacag cagcagcccg tggcggaaac accgtcatct gtgccacaca
     3541 gggaagtgag ggtgaggcaa ctcttgaggg tggagatgac aaaggaacat actgtggggc
     3601 gcccattcta ggccctgggg gggcaccaaa attgagcacc aaaaccaaat tttggaggtc
     3661 atcgaacaca cctcttccac cagggacata tgagcctgcc tatctcggtg gccgtgaccc
     3721 ccgtgttaag ggtgggccct ccttgcagca ggtaatgaga gaccagctga aaccattcac
     3781 tgagcccagg ggtaaacctc caaaaccaag tgtgttggaa gcagccaaac aaaccatcat
     3841 caatgtcctc gaacaaaccc tggaccctcc acaaaaatgg acatacgcac aggcgtgtgc
     3901 ttcacttgac aaaaccacct ccagcgggca tccccaccat gtccgaaaga atgaattctg
     3961 gaatggtgag accttcactg gtaaattggc agaccaagca tcaagagcaa atctaatgtt
     4021 tgaggaaggg aaacacatga caccagtgta cacagcagcc ctcaaggacg agctggtcaa
     4081 gactgacaaa gtttatggaa agatcaagaa gagactgctc tggggctctg acttgtccac
     4141 catgatccgg tgcgccaggt cctttggtgg gctcatggat gagatgaaag cacactgcat
     4201 atcacttcca gtccgagttg gtatgaacat gaatgaagat ggtccaataa tatttgagaa
     4261 gcactccaga tataagtacc actatgatgc agactattcc cgctgggatt caacacaaca
     4321 gagggcagta ctagcagcag ccttggaaat catggtcagg ttctctgcag agccacaatt
     4381 ggcacagata gtcgctgagg atctgctggc ccccagtgtg gtagatgtag gagactttaa
     4441 aatttcaata aatgaagggc tcccctctgg tgtaccatgc acttctcaat ggaattccat
     4501 cgcacactgg ctgctaaccc tctgtgcctt gtctgaagtc accaaactgt cccctgacat
     4561 tgtgcaggca aattccatgt tttcatttta cggtgatgac gagattgtca gcaccgatat
     4621 aaaattggac cctgaaaagt taaccaccaa attgaaggag tacggcctaa aaccaactcg
     4681 cccagacaaa accgagggac ccctgatcat cagtgaggat ctgaacggac tcactttcct
     4741 ccggaggacg gtgactcgtg acccagctgg ctggtttgga aaattggacc aaagctcaat
     4801 attgaggcag atgtactgga ctagagggcc aaatcatgaa gaccccaatg agacaatgat
     4861 accccactct caaagaccca tacagctcat ggcactgctt ggtgaggcct cccttcacgg
     4921 accctctttc tacagcaaag tcagtaaatt ggtcataact gaactcaaag aaggtgggat
     4981 ggatttttac gtgccaaggc aggaacccat gttcaggtgg atgaggtttt ctgacttgag
     5041 cacgtgggag ggcgatcgca atctggctcc caattttgtg aatgaagatg gcgtcgagtg
     5101 acgccgctcc atctaatgat ggtgcagccg gtctcgtacc agaggttaac aacgagacga
     5161 tggcacttga accagttgcg ggagcttcaa tcgccgcccc cttaactggt caaaacaatg
     5221 taatagaccc ctggattaga ttaaattttg tacaagcccc aaatggtgag ttcacggttt
     5281 ccccccgaaa ctcacctggt gaaattctgt taaatttgga gttagggcct gaattgaatc
     5341 catatttagc tcatttggca agaatgtata atggatatgc aggtggggtc gaggtgcagg
     5401 tactgcttgc tggaaatgcg tttacagcgg gcaaactagt atttgcagca gtcccccccc
     5461 atttcccagt ggacaatttg agccccggcc aaatcactat gttcccccat gtgattattg
     5521 atgttagaac ccttgaacct gttttgttac cattacctga tgtaaggaat aatttctttc
     5581 attataatca acagaatgaa tctcgcatga gacttattgc catgctttat acccctctta
     5641 gatctaatgg ttcaggcgat gatgtcttca ctgtgtcttg tagggtttta accagaccat
     5701 cccctgattt tgattttaat tatttggtcc ctccaacagt tgaatctaaa actaaaccct
     5761 tctcagtccc agtgctgacc ctcaatgagc tgaccaactc ccgttttcct gtcccgattg
     5821 atgccatgta cactagcccc aatgacacaa ttgtggtcca acctcaaaat gggagagcaa
     5881 ccattgacgg cgaattgctt ggcacaactc aactcatccc cagtggtatc tgctcattta
     5941 gaggaagaat tacagcacat ctgcaagatg acagtcactt gtggagcgtc caagtcacca
     6001 atctgaatgg cacccctttt gatccaacag atgatgtgcc cgctccattg ggtatgccag
     6061 acttttctgg acaaatattt ggggtgatca gccaaaggga tacaggtagt aacaaccccg
     6121 caaacagatc ccatgatgct gtggttccaa cctacagtcc caaattcact cccaaactcg
     6181 gctcaatcca aattggaacg tgggatacca atgatctaca aaaccagcct gttaaattca
     6241 cgcccgttgg cctcaatgaa attggagatg acaaacattt cgaccaatgg gtgttaccaa
     6301 attattctgg tgccctagga ctcaacatgc acctggctcc tgctgtgtcc ccacttttcc
     6361 ctggagagag attgcttttc tttagatcat acatacccct aaaaggtggc catggaaacc
     6421 catacattga ttgccttgtg ccacaagagt ggatacaaca tttctatcaa gaatcagccc
     6481 cagcacaatc ctcggtggct ctgctgagat atgtgaaccc agacacaggg cgcaccctat
     6541 ttgaggccaa attgcataag gaaggattca ttactgttgc tagcacagaa aacagacctg
     6601 tagttgtccc cccaaatggc tatttcagat ttgattcttg ggtaaaccaa ttttactcac
     6661 tcgcccccat gggaactggc aatgggcgca gaaggatgca gtaatggctg gagcttttat
     6721 agcaggactt gccggtgaca tcgtcaccaa tagtgttggc tcacttgtga acgccggagc
     6781 caatgctata aaccaaaaag ttgattttga aaacaacaaa cagctacaac aggcttcctt
     6841 taaccatgat aaagagatgc tgcaagccca aatccaagcc accaagcagt tgcaggctga
     6901 catgatttca atcagacaag gggttttgac cgcgggcggc ttctccccca ctgatgctgc
     6961 aaggggtgca gtcaacgcac caatgaccca ggtgttggac tggaatggaa ctagatactg
     7021 ggcccctggg gcctcaagga ccaccagctt ttctggtggg ttcaccaaca ccacccgtgc
     7081 cagaacagtt gaaccaccca aaagttcccc ccctgctcac aatactttag cttctgtccc
     7141 taggtctagt tctactgttt catcttcttc tactcgttcg acagtaatta ctagttcttc
     7201 cgctgcccct tctactaggt cttctattac tagaaattca ccccgcaata cttctcaatc
     7261 tgtctcttcc gtttcttctc gcactagtga ttgggtacaa aatcaaaaca gaatgctgga
     7321 gccatatctg aggggatctc tgcaaacagc ctttgtgtca ccgtcctcca gtaaggcctc
     7381 tagtaatggc actgtctcaa ctgtgccaaa agaaattttg gactcctgga catctgcgtt
     7441 caacacccgc agacagccgc ttttcgcaca cctccgccgg aggggggagt cacaagctta
     7501 gtgaaaagac tttgattttc ctttttcttt ctttcttttt attgaaaatt ttgtctttta
     7561 aaaaaaaaaa aaaaaaaaaa
//