Typing tool

Complete norovirus genomes

KF895841  GII.3
 GII.P16

Length: 7,551 | 3 CDS

ORF1: 4..5100
ORF2: 5081..6727
ORF3: 6727..7491
LOCUS       KF895841                7551 bp    RNA     linear   VRL 10-JAN-2019
DEFINITION  Norovirus GII isolate Hu/GII.P16-GII.3/Smolensk/S12-31/2012/RUS,
            complete genome.
ACCESSION   KF895841
VERSION     KF895841.2
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7551)
  AUTHORS   Zhirakovskaia,E., Tikunov,A., Tymentsev,A., Sokolov,S.,
            Sedelnikova,D. and Tikunova,N.
  TITLE     Changing pattern of prevalence and genetic diversity of rotavirus,
            norovirus, astrovirus, and bocavirus associated with childhood
            diarrhea in Asian Russia, 2009-2012
  JOURNAL   Infect. Genet. Evol. 67, 167-182 (2019)
   PUBMED   30414977
REFERENCE   2  (bases 1 to 7551)
  AUTHORS   Zhirakovskaya,E. and Tikunova,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-NOV-2013) Siberian Branch of Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine,
            Lavrentiev Ave. 8, Novosibirsk 630090, Russia
REFERENCE   3  (bases 1 to 7551)
  AUTHORS   Zhirakovskaya,E., Tikunov,A. and Shlyakhtun,V.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-SEP-2015) Siberian Branch of Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine,
            Lavrentiev Ave. 8, Novosibirsk 630090, Russia
  REMARK    Sequence update by submitter
COMMENT     On Sep 16, 2015 this sequence version replaced KF895841.1.
            
            ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7551
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.P16-GII.3/Smolensk/S12-31/2012/RUS"
                     /isolation_source="fecal sample"
                     /host="Homo sapiens; sex: M"
                     /db_xref="taxon:122929"
                     /country="Russia: Smolensk"
                     /collection_date="29-Mar-2012"
                     /note="genotype: GII.P16-GII.3"
     gene            4..5100
                     /gene="POL"
     CDS             4..5100
                     /gene="POL"
                     /note="ORF1; encodes p48, NTPase, p22, VPg, 3CLpro, RdRp"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="ALE30635.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPVPRDNSQKPPRPPTPELVKRIPPPPPNGEEEEPVIRYEVKSGISGLPELTTVPQP
                     DVANTAFSVPPLSLRENREAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAI
                     SMAKVELTPLSLYWRVVYTPQYLISPETLRRLNGEAFPYTAFDNNCYAFCCWVLDLND
                     SWLNRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDLIG
                     KIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPE
                     DLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDMEEEKARRLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRMRPVVVMISGKPGIGKTHLARE
                     VARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADT
                     CPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVE
                     KAKRDFPGQPDMWKDAFKSDFSHIRLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERMDEFELQGPTVTTFNFDRNRITAFRQLAAENKYGLVDTMRVGNQLKGVKT
                     MEELKQAIKNVVIKRCQIIYGGSTYDLESDGKGKVLVEKVRNTSVQTNNELAGALHHL
                     KHARIRYYVKCVQEAVYSIIQIAGAAFVTTRIARRMNIQELWSKPPLDQNESEAKEEV
                     PKSEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEELAIAKATEEDFCEEEEVKIRQRIFRPTRKQRKEERTTLGLVT
                     GSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPS
                     LFITSTHVIPAGITEAFGVPIKQIQVHKSGEFCRFRFPKPIRPDVTGMILEEGAPEGT
                     VATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDC
                     GCPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGP
                     GGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHVRKNEFWN
                     GETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKVYGKIKKRLLWGSDLS
                     TMIRCARSFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVRFSAEPQLAQIVAEDLLAPSVVDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTKLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLKE
                     YGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLDQSSILRQMYWTRGPN
                     HEDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     gene            5081..6727
                     /gene="VP1"
     CDS             5081..6727
                     /gene="VP1"
                     /note="major capsid protein; ORF2"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="AIA96988.2"
                     /translation="MKMASNDAAPSNDGAAGLVPEISNEAMALDPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEILLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKVIFAAIPPNFPTDNLSAAQITMCPHVIVDVRQLEPINLPMPD
                     VRNNFFHYNQGSDSRLRLIAMLYTPLRANNSGDDVFTVSCRVLTRPSPDFSFNFLVPP
                     TVESKTKPFTLPILTISEMSNSRFPVPIDSLHTSPTDNIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGVLTRSTSRASDHADTATPRLFNYYWHIQLDNLNGTPYDPAEDIPAP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKVDTTSGRFTPKLGSLEMSTESDDFDQNQP
                     TRFTPVGIGVDNEADFQQWTLPDYSGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPAQTQVALVRYVNPDTGRVLFEAKLHKLGYMTIA
                     KSGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRIQ"
     gene            6727..7491
                     /gene="VP2"
     CDS             6727..7491
                     /gene="VP2"
                     /note="minor capsid protein; ORF3"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="ALE30636.1"
                     /translation="MAGAFIAGLAGDMLTNTVGSLVNAGAGAINQKVDFENNKYLQNA
                     SFNHDKEMLNAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPITKVLDWSG
                     TRYWAPNATSTTSMSGGFTGQAVHRATPNFKTNQAPKSTPSSGSSVRSSSTQLTNLSS
                     HSSGSSRSSGSTMVSSLPSSSRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSLD
                     TVSTVPKSVLDSWTSAFNTHRQPLFAHLRKRGESNV"
ORIGIN      
        1 tgaatgaaga tggcgtctaa cgacgctacc gttgccgttg cttgcaacaa caacaacgac
       61 aaggaaaaat cttcaggtga aggcttattc acaaatatgt cttccacctt aaagaaagcc
      121 ctcggggccc ggcccaaaca gcctgtcccg agggacaact cacaaaagcc cccaagacca
      181 ccaactcccg agttggttaa gaggataccc cctcccccac ctaatggtga agaagaagaa
      241 ccagtcatta ggtatgaggt taagagtggg atctctggcc tgcccgagct cacaacagtc
      301 ccccaaccgg acgtggccaa cacggcattc agtgttccac cgctgagctt gagagaaaac
      361 agggaggcca aggaaccgct gacaggggca atattagaga tgtgggatgg agagatatac
      421 cactatggcc tgtacgtgga gaagggctta gtgttgggtg tgcacaaacc acctgcagcc
      481 ataagcatgg caaaagtgga gctgacgccg ttgtcattgt actggcgtgt ggtctacacc
      541 ccccagtacc tcatctcccc tgaaactctc aggaggctca acggagaggc attcccttac
      601 accgcctttg acaacaattg ctatgccttt tgctgttggg tattagacct caatgactca
      661 tggcttaaca ggaggatggt gcaaagaaca acaggcttct tcaggcctta ccaagagtgg
      721 aacagaaaac ccctgcctac tatggatgat tccaaaatca agaaggtggc aaacatattc
      781 ctgtgttcat tgtccacgtt gttcaccaga cccataaaag acctcatagg aaaaattaaa
      841 ccattaaaca tcttgaacat cctggcaacg tgtgactgga cattcgccgg aatagtggag
      901 tctttgatat tactcgctga actctttgga gttttctgga cacccccaga tgtgtctgct
      961 atgattgctc ccttacttgg agactacgag ttgcaagggc cagaagacct cgccgttgag
     1021 ctcgtacctg tggtaatggg agggattggt ttggtgttgg gattcaccaa agagaaaatt
     1081 ggcaaaatgt tgtcctcagc agcatcaacg ctcagggctt gtaaagatct tggtgcctat
     1141 ggcttagaga tactcaaatt ggtcatgaag tggttcttcc caaagaaaga agaggccaat
     1201 gagctagcca tggtgagagc tatagaggat gctgtactgg atcttgaggc aatagaaaat
     1261 aaccacatga caactctgtt gaaagacaaa gacagcctag caacctacat gaaaaccctt
     1321 gacatggagg aggaaaaagc cagaagattg tccacaaaat ctgcatcccc tgacatagtt
     1381 gggacgatca acgccctgct ggctcgaata gcagcggcta ggtcactagt ccacagggcc
     1441 aaggaggagt tatctagcag gatgagacca gtagttgtta tgatatctgg caaaccaggg
     1501 ataggcaaaa ctcatttggc cagggaggtg gcaagaaagg tggcatccac tctcacaggg
     1561 gatcaaagag tcgggctcat accgagaaat ggtgtggacc actgggatgc atacaaaggt
     1621 gagagagtcg tgctgtggga cgactatggc atgagcaacc ccattcatga tgctctgcgc
     1681 atacaagaat tggctgatac gtgtcccctt accttaaatt gtgacagaat tgaaaataag
     1741 ggaaaagttt ttgacagtga agttataata attacaacaa accttgccaa tccagctcca
     1801 cttgattatg tcaactttga ggcctgttcc aggagaattg acttcctggt gtacgccgag
     1861 gcaccagaag tagaaaaagc aaaacgagac tttcctggtc aaccagatat gtggaaggac
     1921 gccttcaagt cggacttttc acatatcagg ttgcaactcg cacctcaggg cggctttgac
     1981 aagaatggca acaccccaca tgggaaagga gtgatgaaga ccctcaccac cggttccctg
     2041 attgcccgtg catcaggctt actgcatgag aggatggatg aatttgaact ccaaggcccc
     2101 acagtcacca ccttcaattt cgaccggaac agaatcaccg cattcagaca attggctgca
     2161 gaaaacaagt atgggttggt agacaccatg agagttggca atcaattaaa aggggtgaaa
     2221 accatggaag aactcaaaca agcaatcaaa aatgtggtca tcaagaggtg ccagatcatc
     2281 tacggtggct ccacgtatga ccttgagtct gatggcaagg gcaaagtttt ggtggaaaag
     2341 gtcaggaaca cctctgtaca gaccaacaac gagttggccg gagccctgca tcacctcaaa
     2401 catgcccgaa tcaggtacta tgtcaaatgt gtgcaagaag cagtctactc tatcatacaa
     2461 attgccggcg ctgcgtttgt caccacacgc attgcacgcc gcatgaacat acaagagctt
     2521 tggtcgaagc caccattaga ccaaaatgaa tcagaggcta aggaagaggt ccccaagtca
     2581 gaagatgacg agttcatcat atcttctaag gacatcaagg aggaaggaaa gaagggcaaa
     2641 aacaaaactg gccgtggcaa gaaacacact gcattctcta gcaagggctt gagcgatgag
     2701 gagtatgacg agtacaagag gataagagaa gagagaaatg ggaagtactc tatagaggag
     2761 tatcttcaag acagagacag gtactatgag gagctcgcca tcgccaaggc cacggaagaa
     2821 gatttctgtg aggaggagga ggtcaaaatc cgtcagagga ttttccgtcc caccaggaaa
     2881 caaagaaagg aagagaggac cacactaggg ctagtaactg gttcagaaat cagaaaaaga
     2941 aaccctgatg acttcaaacc taaagggaaa ctgtgggccg atgacaacag aagtgttgac
     3001 tacaatgaga aactggactt tgaggccccc ccaagcatat ggtctaggat tgtgagcttt
     3061 ggttctggct ggggcttctg ggtatcgcca agcctgttca taacatcaac tcatgtaatc
     3121 cctgcaggca taacagaggc atttggggtc cccatcaaac aaatccaggt ccacaaatca
     3181 ggtgaatttt gtcggttcag attcccaaaa ccaattagac cagatgtgac aggaatgatt
     3241 ttggaggaag gcgcgcctga gggcaccgtg gcaaccgtgc tcatcaaacg ccctaccgga
     3301 gagctcatgc cccttgcagc cagaatgggg acacacgcaa ccatgaaaat tcaaggccgc
     3361 atggttggcg gacagatggg tatgttgctc actggttcaa atgctaaagg aatggatttg
     3421 ggaacaactc ctggtgattg tggctgtccc tacatctaca aaaggggcaa tgactatata
     3481 gtcattgggg tgcacacagc agcagcccgt ggtggaaaca ccgtcatctg tgccacacag
     3541 ggaagtgagg gtgaggcaac tcttgagggt ggagatgaca aaggaacata ctgtggggca
     3601 cccattctag gccctggagg ggcaccaaaa ttgagcacca aaaccaaatt ttggaggtca
     3661 tcgaacacgc ctcttccacc agggacatat gagcctgcct acctcggtgg ccgtgacccg
     3721 cgtgtcaagg gtgggccctc cttgcagcag gtaatgagag accagttgaa gccattcact
     3781 gagcccaggg gtaaacctcc aagaccaagt gtgttggagg cagccaaaca aaccatcatc
     3841 aatgtcctcg aacaaaccct ggaccctcca caaaaatgga catacgcaca ggcgtgtgct
     3901 tcacttgaca aaaccacctc cagcgggcat ccccaccacg tccgaaagaa tgaattctgg
     3961 aatggtgaga ccttcacagg taaattggca gaccaagcat caaaagcaaa tctaatgttt
     4021 gaggaaggga aacacatgac accagtgtac acagcagccc tcaaggacga gctggtcaag
     4081 actgacaaag tctatggtaa gatcaagaag agactgctct ggggttctga cttgtccacc
     4141 atgatccggt gcgccaggtc ctttggtggg ctcatggatg agatgaaggc tcactgcata
     4201 tcactcccag tccgagttgg catgaacatg aatgaagatg gcccaataat atttgagaag
     4261 cactccagat acaagtacca ctatgatgca gactactccc gctgggattc aacacaacag
     4321 agggcagtat tagcagcagc cttggaaatc atggtcaggt tctctgcaga gccacaattg
     4381 gcacagatag tcgctgagga tctgttggcc cccagtgtgg tggatgtagg agactttaaa
     4441 atttcaataa atgaagggct cccctctggt gtaccatgca cttctcaatg gaattccatc
     4501 gcacactggc tgctaaccct ctgtgccttg tctgaagtca ccaagctgtc ccctgacatt
     4561 gtacaggcaa attctatgtt ctcattttac ggtgatgacg agattgtcag caccgatata
     4621 aaattggacc ctgaaaagtt aaccaccaaa ttgaaggagt acggcctgaa accaactcgc
     4681 ccagacaaaa ccgagggacc cctgatcatc agtgaggatt tgaacggact cactttcctc
     4741 cggaggacgg tgactcgtga cccagctggc tggtttggaa aattggacca aagttcaata
     4801 ttgaggcaga tgtactggac tagaggacca aatcatgaag accccaatga gacaatgata
     4861 ccccactctc aaagacccat acagctcatg gcactgcttg gtgaggcctc ccttcacggg
     4921 ccctctttct acagcaaaat tagtaaattg gtcataactg aactcaaaga aggtgggatg
     4981 gacttttacg tgccaaggca ggaacccatg ttcaggtgga tgaggttttc tgacttgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc aattttgtga atgaagatgg cgtcgaatga
     5101 cgctgctcca tctaatgatg gtgccgccgg cctcgtacca gagatcagta atgaggcaat
     5161 ggcgctagat ccagtggcgg gtgcagcgat agcagcaccc cttactggcc agcaaaacat
     5221 aatagatccc tggattatga ataattttgt gcaagcacct ggtggtgagt ttacagtgtc
     5281 acccaggaac tcccctggtg aaatacttct aaatttagaa ttaggcccag aaataaatcc
     5341 ctatctggcg catcttgcta ggatgtacaa tggttatgca ggtgggtttg aggtgcaggt
     5401 ggtcctggct ggaaatgcgt ttacagcagg aaaagtgatc tttgcagcta taccccccaa
     5461 tttcccaact gacaatttga gtgcagcgca gattacaatg tgccctcatg taattgtgga
     5521 tgtcaggcag ttggaaccaa tcaacctccc gatgcctgat gtccgcaaca atttctttca
     5581 ttacaatcaa ggttctgatt caaggttacg cttaattgca atgttgtaca caccccttag
     5641 ggcaaataat tctggagatg atgttttcac tgtgtcatgt agggtattga ctaggcccag
     5701 tcctgatttc tcattcaact tcctcgtccc gcccactgtg gaatcaaaga caaaaccttt
     5761 taccctccca attttgacta tctctgagat gtctaattct agatttccag tgccaattga
     5821 ctctctgcac accagtccaa ctgataacat tgttgtccag tgccaaaatg ggcgcgtcac
     5881 ccttgatggt gagctaatgg gcaccaccca actcttgccg agtcagatat gtgcttttag
     5941 gggtgtgctc accagatcaa caagcagggc cagtgaccac gctgacacag caacccccag
     6001 gctcttcaat tactactggc acatacaact agacaaccta aatgggaccc cgtatgatcc
     6061 tgcagaggac ataccagctc ctctggggac accagacttt cggggcaaag tctttggcgt
     6121 ggccagccag agaaaccctg acagcacaac aagggcacat gaggcaaaag tggacacaac
     6181 atctggccgc ttcaccccaa aattaggctc cctagaaatg tccactgaat ctgatgactt
     6241 tgatcaaaat caaccaacaa gattcacccc agttggcatt ggagttgaca atgaggcaga
     6301 ctttcaacaa tggaccttac ctgactattc cggtcagttc acccacaaca tgaatctggc
     6361 cccagctgtc gctcccaatt ttcccggtga acagcttctt ttcttccgct cacagctgcc
     6421 atcctctggc gggcggtcca atggtattct agactgcctg gtcccccagg aatgggtcca
     6481 acatttctat caggaatccg cccctgccca gacgcaggtg gctctggtca ggtatgtcaa
     6541 tcctgatact ggtagggtgt tatttgaggc taagctgcat aagctaggct acatgaccat
     6601 agctaagagt ggtgattctc caataactgt acccccaaat ggatacttta ggtttgaatc
     6661 ttgggtgaac cccttttaca cactagcccc catgggaact gggaatgggc gtagaaggat
     6721 tcaataatgg ctggagcctt tatagcagga ttggctggtg acatgctcac aaatactgta
     6781 gggtctttag ttaatgcagg ggctggtgct attaatcaaa aagttgattt tgaaaataat
     6841 aaatatctac aaaatgcatc ctttaatcat gataaggaga tgttaaatgc acaaattgag
     6901 gcaacaaaga ggctacaggc tgacatgatt gctatcaaac aaggggtttt gaccgctggc
     6961 ggtttctccc ccactgatgc agcccgtggg gctattaacg cccccataac aaaagttctg
     7021 gactggagtg gaaccaggta ctgggcacca aatgccacct ccacaacttc aatgtcaggt
     7081 ggctttacag gtcaagctgt acacagagct acaccaaatt ttaaaaccaa tcaagcccca
     7141 aaatccacac ccagcagtgg gtcttcagtg aggtcaagct caacccaact caccaacttg
     7201 agctcacact catctgggtc ttctcgatcc agcggatcca cgatggtcag ctcgttacca
     7261 tcttccagta ggactagaga ctgggttaac caacagaatt tcaatttgga accacacatg
     7321 cctggatctc tcaggacagc ttttgttact ccaccatcta gtacagcctc tagcttagac
     7381 acggtctcaa ccgtgcccaa gagtgttttg gactcctgga catctgcgtt taacacgcac
     7441 agacagccgc ttttcgcaca ccttcgtaaa aggggggagt caaatgttta gtgaaaagat
     7501 tatttttaaa tttggtttgt aattggattt aaattagaat cttttaaaaa a
//