Typing tool

Complete norovirus genomes

KF429770  GI.1
 GI.P1

Length: 7,626 | 3 CDS

ORF1: 5..5374
ORF2: 5358..6950
ORF3: 6950..7588
LOCUS       KF429770                7626 bp ss-RNA     linear   VRL 14-AUG-2013
DEFINITION  Norovirus Hu/GI.1/8McIII/1973/USA, complete genome.
ACCESSION   KF429770
VERSION     KF429770.1
DBLINK      BioProject: PRJNA70471
KEYWORDS    .
SOURCE      Norovirus Hu/GI.1/8McIII/1973/USA
  ORGANISM  Norovirus Hu/GI.1/8McIII/1973/USA
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7626)
  AUTHORS   Madupu,R., Halpin,R.A., Ransier,A., Fedorova,N., Tsitrin,T.,
            McLellan,M., Stockwell,T., Amedeo,P., Appalla,L., Bishop,B.,
            Edworthy,P., Gupta,N., Hoover,J., Katzel,D., Li,K., Schobel,S.,
            Shrivastava,S., Thovarai,V., Wang,S., Kim,M., Bok,K.,
            Sosnovtsev,S.V., Wentworth,D.E. and Green,K.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-JUN-2013) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
COMMENT     This work was supported by the National Institute of Allergy and
            Infectious Diseases (NIAID), Genome Sequencing Centers for
            Infectious Diseases (GSCID) program.
            The genome sequence was generated using overlapping PCR amplicons
            spanning the genome. The amplicons were pooled by sample and then
            barcoded and sequenced using Next Generation Sequencing platforms.
            The consensus sequences of the internal PCR primer hybridization
            sites were manually verified using reads from amplicons that
            spanned across the sites.
            
            ##Genome-Assembly-Data-START##
            Current Finishing Status :: Finished
            Assembly Method          :: clc_ref_assemble_long v. 3.22.55705
            Genome Coverage          :: 3415.6x
            Sequencing Technology    :: Illumina
            ##Genome-Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7626
                     /organism="Norovirus Hu/GI.1/8McIII/1973/USA"
                     /mol_type="genomic RNA"
                     /strain="Hu/GI.1/8McIII/1973/USA"
                     /host="Homo sapiens"
                     /db_xref="taxon:1383580"
                     /country="USA: Maryland"
                     /collection_date="14-Dec-1973"
                     /PCR_primers="fwd_name: 1_Forward, fwd_seq:
                     gaatgatgatggcgtcaa, rev_name: 1_Reverse, rev_seq:
                     ggagttggaactcatcctgt"
                     /PCR_primers="fwd_name: 2_Forward, fwd_seq:
                     gtcgttcctactgctgcta, rev_name: 2_Reverse, rev_seq:
                     tacactggcaccatctgatt"
                     /PCR_primers="fwd_name: 3_Forward, fwd_seq:
                     tagtcatcaccaccaatgct, rev_name: 3_Reverse, rev_seq:
                     aaagggtttcagttggtcac"
                     /PCR_primers="fwd_name: 4_Forward, fwd_seq:
                     tttggtaagggtgtgatgaa, rev_name: 4_Reverse, rev_seq:
                     ttttgtcaagagattggcag"
                     /PCR_primers="fwd_name: 5_Forward, fwd_seq:
                     ccacgagattgtgaggtatg, rev_name: 5_Reverse, rev_seq:
                     gccatccaattcagtaaggt"
                     /PCR_primers="fwd_name: 6_Forward, fwd_seq:
                     cccagcactgtcaactaaaa, rev_name: 6_Reverse, rev_seq:
                     ggccaaactgtgtcatattg"
                     /PCR_primers="fwd_name: 7_Forward, fwd_seq:
                     aatggttgggttggtaacat, rev_name: 7_Reverse, rev_seq:
                     gcgtggtatggagaaagatt"
                     /PCR_primers="fwd_name: 8_Forward, fwd_seq:
                     ctggtaatgcctttactgc, rev_name: 8_Reverse, rev_seq:
                     aattaaatgaatatgatgcccac"
     gene            5..5374
                     /gene="POL"
                     /locus_tag="H649_43483gpPOL"
     CDS             5..5374
                     /gene="POL"
                     /locus_tag="H649_43483gpPOL"
                     /note="genome polyprotein"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AGT17802.1"
                     /translation="MMMASKDVVPTAASSENANNNSSIKSRLLARLKGSGGATSPPNS
                     IKITNQDMALGLIGQVPAPKATSVDVPKQQRDRPPRTVAEVQQNLRWTERPQDQNVKT
                     WDELDHTTKQQILDEHAEWFDAGGLGPSTLPTSHERYTHENDEGHQVKWSAREGVDLG
                     ISGLTTVSGPEWNMCPLPPVDQRSTTPATEPTIGDMIEFYEGHIYHYAIYIGQGKTVG
                     VHSPQAAFSITRITIQPISAWWRVCYVPQPKQRLTYDQLKELENEPWPYAAVTNNCFE
                     FCCQVMCLEDTWLQRKLISSGRFYHPTQDWSRDTPEFQQDSKLEMVRDAVLAAINGLV
                     SRPFKDLLGKLKPLNVLNLLSNCDWTFMGVVEMVVLLLELFGIFWNPPDVSNFIASLL
                     PDFHLQGPEDLARDLVPIVLGGIGLAIGFTRDKVSKMMKNAVDGLRAATQLGQYGLEI
                     FSLLKKYFFGGDQTEKTLKDIESAVIDMEVLSSTSVTQLVRDKQSARAYMAILDNEEE
                     KARKLSVRNADPHVVSSTNALISRISMARAALAKAQAEMTSRMRPVVIMMCGPPGIGK
                     TKAAEHLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMTKIQEDCNKL
                     QAIADSAPLTLNCDRIENKGMQFVSDAIVITTNAPGPAPVDFVNLGPVCRRVDFLVYC
                     TAPEVEHTRKVSPGDTTALKDCFKPDFSHLKMELAPQGGFDNQGNTPFGKGVMKPTTI
                     NRLLIQAVALTMERQDEFQLQGPTYDFDTDRVAAFTRMARANGLGLISMASLGKKLRS
                     VTTIEGLKNALSGYKISKCSIQWQSRVYIIESDGASVQIKEDKQALTPLQQTINTASL
                     AITRLKAARAVAYASCFQSAITTILQMAGSALVINRAVKRMFGTRTAAMALEGPGKEH
                     NCRVHKAKEAGKGPIGHDDMVERFGLCETEEEESEDQIQMVPSDAVPEGKNKGKTKKG
                     RGRKNNYNAFSRRGLSDEEYEEYKKIREEKNGNYSIQEYLEDRQRYEEELAEVQAGGD
                     GGIGETEMEIRHRVFYKSKSKKHQQEQRRQLGLVTGSDIRKRKPIDWTPPKNEWADDD
                     REVDYNEKINFEAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVVPTGVKEFFGEPLSS
                     IAIHQAGEFTQFRFSKKMRPDLTGMVLEEGCPEGTVCSVLIKRDSGELLPLAVRMGAI
                     ASMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVHKRGNDWVVCGVHAAATK
                     SGNTVVCAVQAGEGETALEGGDKGHYAGHEIVRYGSGPALSTKTKFWRSSPEPLPPGV
                     YEPAYLGGKDPRVQNGPSLQQVLRDQLKPFADPRGRMPEPGLLEAAVETVTSMLEQTM
                     DTPSPWSYADACQSLDKTTSSGYPHHKRKNDDWNGTTFVGELGEQAAHANNMYENAKH
                     MKPIYTAALKDELVKPEKIYQKVKKRLLWGADLGTVVRAARAFGPFCDAIKSHVIKLP
                     IKVGMNTIEDGPLIYAEHAKYKNHFDADYTAWDSTQNRQIMTESFSIMSRLTASPELA
                     EVVAQDLLAPSEMDVGDYVIRVKEGLPSGFPCTSQVNSINHWIITLCALSEATGLSPD
                     VVQSMSYFSFYGDDEIVSTDIDFDPARLTQILKEYGLKPTRPDKTEGPIQVRKNVDGL
                     VFLRRTISRDAAGFQGRLDRASIERQIFWTRGPNHSDPSETLVPHTQRKIQLISLLGE
                     ASLHGEKFYRKISSKVIHEIKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRDLLPEFV
                     NDDGV"
     mat_peptide     5..1198
                     /gene="POL"
                     /locus_tag="H649_43483gpPOL"
                     /product="protein p37"
     mat_peptide     1199..2287
                     /gene="POL"
                     /locus_tag="H649_43483gpPOL"
                     /product="NTPase"
                     /note="p40"
     mat_peptide     2288..2890
                     /gene="POL"
                     /locus_tag="H649_43483gpPOL"
                     /product="protein p20"
     mat_peptide     2891..3304
                     /gene="POL"
                     /locus_tag="H649_43483gpPOL"
                     /product="viral genome-linked protein"
                     /note="VPg"
     mat_peptide     3305..3847
                     /gene="POL"
                     /locus_tag="H649_43483gpPOL"
                     /product="3C-like protease"
                     /note="3CLpro; calicivirin"
     mat_peptide     3848..5371
                     /gene="POL"
                     /locus_tag="H649_43483gpPOL"
                     /product="RNA-directed RNA polymerase"
     gene            5358..6950
                     /gene="VP1"
                     /locus_tag="H649_43483gpVP1"
     CDS             5358..6950
                     /gene="VP1"
                     /locus_tag="H649_43483gpVP1"
                     /note="p59"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="AGT17803.1"
                     /translation="MMMASKDATSSVDGASGAGQLVPEVNASDPLAMDPVAGSSTAVA
                     TAGQVNPIDPWIINNFVQAPQGEFTISPNNTPGDVLFDLSLGPHLNPFLLHLSQMYNG
                     WVGNMRVRIMLAGNAFTAGKIIVSCIPPGFGSHNLTIAQATLFPHVIADVRTLDPIEV
                     PLEDVRNVLFHNNDRNQQTMRLVCMLYTPLRTGGGTGDSFVVAGRVMTCPSPDFNFLF
                     LVPPTVEQKTRPFTLPNLPLSSLSNSRAPLPISSMGISPDNVQSVQFQNGRCTLDGRL
                     VGTTPVSLSHVAKIRGTSNGTVINLTELDGTPFHPFEGPAPIGFPDLGGCDWHINMTQ
                     FGHSSQTQYDVDTTPDTFVPHLGSIQANGIGSGNYVGVLSWISPPSHPSGSQVDLWKI
                     PNYGSSITEATHLAPSVYPPGFGEVLVFFMSKMPGPGAYNLPCLLPQEYISHLASEQA
                     PTVGEAALLHYVDPDTGRNLGEFKAYPDGFLTCVPNGASSGPQQLPINGVFVFVSWVS
                     RFYQLKPVGTASSARGRLGLRR"
     gene            6950..7588
                     /gene="VP2"
                     /locus_tag="H649_43483gpVP2"
     CDS             6950..7588
                     /gene="VP2"
                     /locus_tag="H649_43483gpVP2"
                     /note="minor capsid protein; basic protein"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="AGT17804.1"
                     /translation="MAQAIIGAIAASTAGSALGAGIQVGGEAALQSQRYQQNLQLQEN
                     SFKHDREMIGYQVEASNQLLAKNLATRYSLLRAGGLTSADAARSVAGAPVTRIVDWNG
                     VRVSAPESSATTLRSGGFMSVPIPFASKQKQVQSSGISNPNYSPSSISRTTSWVESQN
                     SSRFGNLSPYHAEALNTVWLTPPGSTASSTLSSVPRGYFNTDRLPLFANNRR"
     primer_bind     complement(7605..7626)
ORIGIN      
        1 gtgaatgatg atggcgtcaa aagacgtcgt tcctactgct gctagcagtg aaaatgctaa
       61 caacaatagt agtattaagt ctcgtctatt ggcgagactc aagggttcag gtggggctac
      121 gtccccaccc aactcgataa agataaccaa ccaagatatg gctctggggc tgattggaca
      181 ggtcccagcg ccaaaggcca catccgtcga tgtccctaaa caacagaggg atagaccacc
      241 acggactgtt gccgaagttc aacaaaattt gcgttggact gagagaccac aagaccagaa
      301 tgttaagacg tgggatgagc ttgaccacac aacaaaacaa cagatacttg atgaacacgc
      361 tgagtggttt gatgccggtg gcttaggtcc aagtacacta cccactagtc atgaacggta
      421 cacacatgag aatgatgaag gccaccaggt aaagtggtcg gctagggaag gtgtagacct
      481 tggcatatcc gggctcacga cggtgtctgg gcctgagtgg aatatgtgcc cgctaccacc
      541 agttgaccaa aggagcacga cacctgcaac tgagcccaca attggtgaca tgatcgaatt
      601 ctatgaaggg cacatctatc attatgctat atacataggt caaggcaaga cggtgggtgt
      661 acactcccct caagcagcct tctcaataac gaggatcacc atacagccca tatcagcttg
      721 gtggcgagtc tgttatgtcc cacaaccaaa acagaggctc acatacgacc aactcaaaga
      781 attagaaaat gaaccatggc cgtatgccgc agtcacgaac aactgcttcg aattttgttg
      841 ccaggtcatg tgcttggaag atacttggtt gcaaaggaag ctcatctcct ctggccggtt
      901 ttaccacccg acccaagatt ggtcccgaga cactccagaa ttccaacaag acagcaagtt
      961 agagatggtt agggatgcag tgctagccgc tataaatggg ttggtgtcgc ggccatttaa
     1021 agatcttctg ggtaagctca aacccttgaa cgtgcttaac ttactttcaa actgtgattg
     1081 gacgttcatg ggggtcgtgg agatggtggt cctcctttta gaactctttg gaatcttttg
     1141 gaacccacct gatgtttcca actttatagc ttcactcctg ccagatttcc atctacaggg
     1201 ccccgaggac cttgccaggg atctcgtgcc aatagtattg ggggggatcg gcttagccat
     1261 aggattcacc agagacaagg taagtaagat gatgaagaat gctgttgatg gacttcgtgc
     1321 ggcaacccag ctcggtcaat atggcctaga aatattctca ttactaaaga agtacttctt
     1381 cggtggtgat caaacagaga aaaccctaaa agatattgag tcagcagtta tagatatgga
     1441 agtactatca tctacatcag tgactcagct cgtgagggac aaacagtctg cacgggctta
     1501 tatggccatc ttagataatg aagaagaaaa ggcaaggaaa ttatctgtca ggaatgccga
     1561 cccacacgta gtatcctcta ccaatgctct catatcccgg atctcaatgg ctagggctgc
     1621 attggccaag gctcaagctg aaatgaccag caggatgcgt cctgtggtca ttatgatgtg
     1681 tgggccccct ggtataggta aaaccaaggc agcagaacat ctggctaaac gcctagccaa
     1741 tgagatacgg cctggtggta aggttgggct ggtcccacgg gaggcagtgg atcattggga
     1801 tggatatcac ggagaggaag tgatgctgtg ggacgactat ggaatgacaa agatacagga
     1861 agactgtaat aaactgcaag ccatagccga ctcagccccc ctaacactca attgtgaccg
     1921 aatagaaaac aagggaatgc aatttgtgtc tgatgctata gtcatcacca ccaatgctcc
     1981 tggcccagcc ccagtggact ttgtcaacct cgggcctgtt tgccgaaggg tggacttcct
     2041 tgtgtattgc acggcacctg aagttgaaca cacgaggaaa gtcagtcctg gggacacaac
     2101 tgcactgaaa gactgcttca agcccgattt ctcacatcta aaaatggagt tggctcccca
     2161 agggggcttt gataaccaag ggaatacccc gtttggtaag ggtgtgatga agcccaccac
     2221 cataaacagg ctgttaatcc aggctgtagc cttgacgatg gagagacagg atgagttcca
     2281 actccagggg cctacgtatg actttgatac tgacagagta gctgcgttca cgaggatggc
     2341 ccgagccaac gggttgggtc tcatatccat ggcctcccta ggcaaaaagc tacgcagtgt
     2401 caccactatt gaaggattaa agaatgctct atcaggctat aaaatatcaa aatgcagtat
     2461 acaatggcag tcaagggtgt acattataga atcagatggt gccagtgtac aaatcaaaga
     2521 agacaagcaa gctttgaccc ctctgcagca gacaattaac acggcctcac ttgccatcac
     2581 tcgactcaaa gcagctaggg ctgtggcata cgcttcatgt ttccagtccg ccataactac
     2641 catactacaa atggcgggat ctgcgctcgt tattaatcga gcggtcaagc gtatgtttgg
     2701 tacccgtaca gcagccatgg cattagaagg acctgggaaa gaacataatt gcagggtcca
     2761 taaggctaag gaagctggaa aggggcccat aggtcatgat gacatggtag aaaggtttgg
     2821 cctatgtgaa actgaagagg aggagagtga ggaccaaatt caaatggtac caagtgatgc
     2881 cgtcccagaa ggaaagaaca aaggcaagac caaaaaggga cgtggtcgca aaaataacta
     2941 taatgcattc tctcgccgtg gtctgagtga tgaagaatat gaagagtaca aaaagatcag
     3001 agaagaaaag aatggcaatt atagtataca agaatacttg gaggaccgcc aacgatatga
     3061 ggaagaatta gcagaggtac aggcaggtgg tgatggtggc ataggagaaa ctgaaatgga
     3121 aatccgtcac agggtcttct ataaatccaa gagtaagaaa caccaacaag agcaacggcg
     3181 acaacttggt ctagtgactg gatcagacat cagaaaacgt aagcccattg actggacccc
     3241 gccaaagaat gaatgggcag atgatgacag agaggtggat tataatgaaa agatcaattt
     3301 tgaagctccc ccgacactat ggagccgagt cacaaagttt ggatcaggat ggggcttttg
     3361 ggtcagcccg acagtgttca tcacaaccac acatgtagtg ccaactggtg tgaaagaatt
     3421 ctttggtgag cccctatcta gtatagcaat ccaccaagca ggtgagttca cacaattcag
     3481 gttctcaaag aaaatgcgcc ctgacttgac aggtatggtc cttgaagaag gttgccctga
     3541 agggacagtc tgctcagtcc taattaaacg ggattcgggt gaactacttc cgctagccgt
     3601 ccgtatgggg gctattgcct ccatgaggat acagggtcgg cttgtccatg gccaatcagg
     3661 gatgttactg acaggggcca atgcaaaggg gatggatctt ggcactatac caggagactg
     3721 cggggcacca tacgtccaca agcgcgggaa tgactgggtt gtgtgtggag tccacgctgc
     3781 agccacaaag tcaggcaaca ccgtggtctg cgctgtacag gctggagagg gcgaaaccgc
     3841 actagaaggt ggagacaagg ggcattatgc cggccacgag attgtgaggt atggaagtgg
     3901 cccagcactg tcaactaaaa caaaattctg gaggtcctcc ccagaaccac tgccccccgg
     3961 agtatatgag ccagcatacc tggggggcaa ggacccccgt gtacagaatg gcccatccct
     4021 acaacaggta ctacgtgacc aactgaaacc ctttgcggac ccccgcggcc gcatgcctga
     4081 gcctggccta ctggaggctg cggttgagac tgtaacatcc atgttagaac agacaatgga
     4141 taccccaagc ccgtggtctt acgctgatgc ctgccaatct cttgacaaaa ctactagttc
     4201 ggggtaccct caccataaaa ggaagaatga tgattggaat ggcaccacct tcgttggaga
     4261 gctcggtgag caagctgcac acgccaacaa tatgtatgag aatgctaaac atatgaaacc
     4321 catttacact gcagccttaa aagatgaact agtcaagcca gaaaagattt atcaaaaagt
     4381 caagaagcgt ctactatggg gcgccgatct cggaacagtg gtcagggccg cccgggcttt
     4441 tggcccattt tgtgacgcta taaaatcaca tgtcatcaaa ttgccaataa aagttggcat
     4501 gaacacaata gaagatggcc ccctcatcta tgctgagcat gctaaatata agaatcattt
     4561 tgatgcagat tatacagcat gggactcaac acaaaataga caaattatga cagaatcctt
     4621 ctccattatg tcgcgcctta cggcctcacc agaattggcc gaggttgtgg cccaagattt
     4681 gctagcacca tctgagatgg atgtaggtga ttatgtcatc agggtcaaag aggggctgcc
     4741 atctggattc ccatgtactt cccaggtgaa cagcataaat cactggataa ttactctctg
     4801 tgcactgtct gaggccactg gtttatcacc tgatgtggtg caatccatgt catatttctc
     4861 attttatggt gatgatgaga ttgtgtcaac tgacatagat tttgacccag cccgcctcac
     4921 tcaaattctc aaggaatatg gcctcaaacc aacaaggcct gacaaaacag aaggaccaat
     4981 acaagtgagg aaaaatgtgg atggactggt cttcttgcgg cgcaccattt cccgtgatgc
     5041 ggcagggttc caaggcaggt tagatagggc ttcgattgaa cgccaaatct tctggacccg
     5101 cgggcccaat cattcagatc catcagagac tctagtgcca cacactcaaa gaaaaataca
     5161 gttgatttca cttctagggg aagcttcact ccatggtgag aaattttaca gaaagatttc
     5221 cagcaaggtc atacatgaaa tcaagactgg tggattggaa atgtatgtcc caggatggca
     5281 ggccatgttc cgctggatgc gcttccatga cctcggattg tggacaggag atcgcgatct
     5341 tctgcccgaa ttcgtaaatg atgatggcgt ctaaggacgc tacatcaagc gtggatggcg
     5401 ctagtggcgc tggtcagttg gtaccggagg ttaatgcttc tgaccctctt gcaatggatc
     5461 ctgtagcagg ttcttcgaca gcagtcgcga ctgctggaca agttaatcct attgatccct
     5521 ggataattaa taattttgtg caagcccccc aaggtgaatt tactatttcc ccaaataata
     5581 cccccggtga tgttttgttt gatttgagtt tgggtcccca tcttaatcct ttcttgctcc
     5641 atctatcaca aatgtataat ggttgggttg gtaacatgag agtcaggatt atgctagctg
     5701 gtaatgcctt tactgcgggg aagataatag tttcctgcat accccctggt tttggttcac
     5761 ataatcttac tatagcacaa gcaactctct ttccacatgt gattgctgat gttaggactc
     5821 tagaccccat tgaggtgcct ttggaagatg ttaggaatgt tctctttcat aataatgata
     5881 gaaatcaaca aaccatgcgc cttgtgtgca tgctgtacac ccccctccgc actggtggtg
     5941 gtactggtga ttcttttgta gttgcagggc gagttatgac ttgccccagt cctgatttta
     6001 atttcttgtt tttagtccct cctacggtgg agcagaaaac caggcccttc acactcccaa
     6061 atctgccatt gagttctctg tctaactcac gtgcccctct cccaatcagt agtatgggca
     6121 tttccccaga caatgtccag agtgtgcagt tccaaaatgg tcggtgtact ctggatggcc
     6181 gcctggttgg caccacccca gtttcattgt cacatgttgc caagataaga gggacctcca
     6241 atggcactgt aatcaacctt actgaattgg atggcacacc ctttcaccct tttgagggcc
     6301 ctgcccccat tgggtttcca gacctcggtg gttgtgattg gcatatcaat atgacacagt
     6361 ttggccattc tagccagacc cagtatgatg tagacaccac ccctgacact tttgtccccc
     6421 atcttggttc aattcaggca aatggcattg gcagtggtaa ttatgttggt gttcttagct
     6481 ggatttcccc cccatcacac ccgtctggct cccaagttga cctttggaag atccccaatt
     6541 atgggtcaag tattacggag gcaacacatc tagccccttc tgtatacccc cctggtttcg
     6601 gagaggtatt ggtctttttc atgtcaaaaa tgccaggtcc tggtgcttat aatttgccct
     6661 gtctattacc acaagagtac atttcacatc ttgctagtga acaagcccct actgtaggtg
     6721 aggctgccct gctccactat gttgaccctg ataccggtcg gaatcttggg gaattcaaag
     6781 cataccctga tggtttcctc acttgtgtcc ccaatggggc tagctcgggt ccacaacagc
     6841 tgccgatcaa tggggtcttt gtctttgttt catgggtgtc cagattttat caattaaagc
     6901 ctgtgggaac tgccagctcg gcaagaggta ggcttggtct gcgccgataa tggcccaagc
     6961 cataattggt gcaattgctg cttccacagc aggtagtgct ctgggagcgg gcatacaggt
     7021 tggtggcgaa gcggccctcc aaagccaaag gtatcaacaa aatttgcaac tgcaagaaaa
     7081 ttcttttaaa catgacaggg aaatgattgg gtatcaggtt gaagcttcaa atcaattatt
     7141 ggctaaaaat ttggcaacta gatattcact cctccgtgct gggggtttga ccagtgctga
     7201 tgcagcaaga tctgtggcag gagctccagt cacccgcatt gtagattgga atggcgtgag
     7261 agtgtctgct cccgagtcct ctgctaccac attgagatcc ggtggcttca tgtcagttcc
     7321 cataccattt gcctctaagc aaaaacaggt tcaatcatct ggtattagta atccaaatta
     7381 ttccccttca tccatttctc gaaccactag ttgggtcgag tcacaaaact catcgagatt
     7441 tggaaatctt tctccatacc acgcggaggc tctcaataca gtgtggttga ctccacccgg
     7501 ttcaacagcc tcttctacac tgtcttctgt gccacgtggt tatttcaata cagacaggtt
     7561 gccattattc gcaaataata ggcgatgatg ttgtaatatg aaatgtgggc atcatattca
     7621 tttaat
//