Typing tool

Complete norovirus genomes

KF306213  GII.3
 GII.P12

Length: 7,578 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6731
ORF3: 6731..7495
LOCUS       KF306213                7578 bp    RNA     linear   VRL 16-APR-2014
DEFINITION  Norovirus Hu/GII.3/Jingzhou/2013402/CHN, complete genome.
ACCESSION   KF306213
VERSION     KF306213.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.3/Jingzhou/2013402/CHN
  ORGANISM  Norovirus Hu/GII.3/Jingzhou/2013402/CHN
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7578)
  AUTHORS   Huo,Y., Cai,A., Yang,H., Zhou,M., Yan,J., Liu,D. and Shen,S.
  TITLE     Complete nucleotide sequence of a norovirus GII.4 genotype:
            evidence for the spread of the newly emerged pandemic Sydney 2012
            strain to China
  JOURNAL   Virus Genes 48 (2), 356-360 (2014)
   PUBMED   24282081
REFERENCE   2  (bases 1 to 7578)
  AUTHORS   Huo,Y.Q., Zhou,M.L., Yang,H., Cai,A.L., Yan,J.X., Liu,D.X. and
            Shen,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUN-2013) Gene Department, Wuhan Institute of
            Biological Products, No. 9, Linjiang Road, Wuchan District, Wuhan,
            Hubei 430062, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7578
                     /organism="Norovirus Hu/GII.3/Jingzhou/2013402/CHN"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.3/Jingzhou/2013402/CHN"
                     /host="Homo sapiens"
                     /db_xref="taxon:1406148"
                     /country="China"
                     /collection_date="Apr-2013"
     CDS             5..5104
                     /codon_start=1
                     /product="nonstructural protein"
                     /protein_id="AGX01094.1"
                     /translation="MKMASNDASAAAAANSNNDTAKSSSDGVLSSMAVTFKRALGARH
                     KQPPPREIPQRPPRPPTPELIKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVRQPD
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     VRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLLDTMRVGKQLKDVKTM
                     PELKQALKNVAIKNCQIVYGGCTYRLESDGKGDVKVDRVQNATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEETVSKDGC
                     PKPKDDEEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERTSLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDHNERLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIVNVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6731
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="AGX01095.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEISSEAMALEPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPVNLPMPD
                     VRNNFFHYNQGSDSRLRLIAMLYTPLRANNSGDDVFTVSCRVLTRPSPDFSFNFLVPP
                     TVESKTKPFSLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGTLTRSTSRASDQADTATPRLFNYYWHIQLDNLNGTPYDPAEDIPAP
                     LGTPDFRGKVFGVASQRNPDATTRAHEAKIDTTSGRFTPKLGSLEISTESGDFDQNQP
                     TRFTPVGIGVDHEPDFQQWALPDYAGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPSQTQVALVRYVNPDTGRVLFEAKLHKLRFMTIA
                     KSGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRIQ"
     CDS             6731..7495
                     /codon_start=1
                     /product="minor capsid protein VP2"
                     /protein_id="AGX01096.1"
                     /translation="MAGAFIAGLAGDMLTNTVGSLVNAGANAINQTIDFENNKYLQNA
                     SFNHDKEMLSAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPMTKVLDWNG
                     TRYWAPGATSTTSMSGGFTNQTAHRPTPNFKTNQAPKPTPNSGSSVRSNSTQITSLSS
                     HSSGSSRSSGSTVVSSIPSSNRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSSG
                     TVSTVPKNVLDSWTSAFNTRRQPLFAHLRRRGESNV"
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gctgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcataaac agcctccccc gagggaaata ccacaaaggc ctccacggcc
      181 acccacccca gaattgatca aaaagatccc tcctccccca cccaacgggg aggatgaact
      241 agtggtctct tacagcgcca aagatggcgt ttctggtttg cctgagctca ccactgtcag
      301 gcagccggat gaaaccaaca cggcgttcag tgttccccca ctcaaccaga gggagaacag
      361 ggacgccaag gagccactga ccggaacaat cctggaaatg tgggatgggg agatctatca
      421 ttatggtctg tatgtggagc gaggccttgt gcttggtgtg cacaaaccac cagctgccat
      481 cagcctcgcc aaggttgaac tcgcaccact ttctctattt tggaggccag tgtacacacc
      541 acagtatctc atctctccag acactcttag gaggctgcat ggagagtcgt tcccttacac
      601 agcctttgac aacaactgct atgccttctg ttgttgggtt cttgacctaa acgactcgtg
      661 gttgtgcagg agaatgatcc aaaggacaac tggtttcttc agaccttacc aagactggaa
      721 caggaaaccc ctccccacta tggatgactc caaattaaag aaggtagcca acatattctt
      781 gtgtgcgcta tcttcgctat tcactaggcc tatcaaagat ataataggaa aggtgagacc
      841 gctcaacatc cttaacatct tggcctcatg tgattggact tttgcaggca tagtagaatc
      901 tttgattctc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttactaggtg actacgaact gcaggggcct gaggaccttg cagtggaact
     1021 cgtaccagta gtgatggggg ggattggttt ggtgctagga ttcaccaaag agaagatcgg
     1081 aaaaatgttg tcatctgctg catccacctt aagagcttgt aaagatcttg gtgcatatgg
     1141 attggaaatc ctaaaattgg tcatgaagtg gttcttccca aagaaagagg aggcaaatga
     1201 gctggccatg gtgaggtcca ttgaggatgc ggtgctggac ctcgaagcaa ttgagaacaa
     1261 ccacatgact gccctcctca aagacaaaga cagtttggca acctacatga gaacccttga
     1321 cctcgaggag gagaaagcca ggaaactttc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gccctactgg cgagaatcgc cgctgcacgt tccctggtgc atcgggcgaa
     1441 agaggaactc tccagcaggc caagacctgt tgttgttatg atatcaggca ggccagggat
     1501 agggaaaact caccttgcca gggagctagc caagaaaatc gcggcttcgc ttacagggga
     1561 ccagcgtgtg ggcctcatcc ctcgcaatgg cgttgatcac tgggatgcat ataagggtga
     1621 aagagtcgtc ctatgggatg attatggaat gagtaatccc atccacgacg ccctcaggtt
     1681 acaggaactt gctgacacct gcccccttac gctgaactgt gacaggattg agaacaaggg
     1741 aaaggtcttt gacagtgatg ccataatcat caccactaat ctggccaacc cagcaccatt
     1801 ggactatgtc aactttgaag catgctcgag acgcattgac ttcctcgtgt atgcagaagc
     1861 ccctgaggtc gagaaggcaa agcgtgattt cccaggtcaa cctgacatgt ggaagaacgc
     1921 atttagttct gacttctcgc acataaaatt ggcgctggct ccgcagggtg gtttcgacaa
     1981 gaacggaaac accccacacg ggaaaggcgt tatgaaaacc cttaccactg gttccctcat
     2041 cgcccgagca tcagggctac tccatgagag gttagatgag tatgagctgc agggcccaac
     2101 tcccaccacc tttaactttg accgcaataa ggtgcttgcg ttcagacagc ttgctgccga
     2161 aaacaagtac ggattgttgg acacaatgag agttggaaag cagctcaagg atgtcaagac
     2221 catgccagag ctcaaacagg cactcaagaa tgtcgcaatc aagaattgtc agatagtgta
     2281 tggtggctgc acttataggc ttgagtctga tggcaagggt gatgtgaaag ttgacagagt
     2341 tcagaacgcc actgtacaga ccaacaatga acttgccggc gccctacacc accttaggtg
     2401 tgccagaatc agatattatg tcaagtgtgt ccaagaggcc ctgtattcca tcatccaaat
     2461 tgctggagct gcatttgtga ccacgcgcat tgtcaagcgc atgaacatac aagacctctg
     2521 gtccaagcca caggtagagg atacagagga aaccgtcagc aaggatgggt gcccaaaacc
     2581 caaggatgat gaagagttcg ttgtctcatc cgatgacatc aaaaccgagg gcaagaaggg
     2641 gaagaacaaa tctggccgtg gtaagaagca cacggcattc tcaagtaaag gtctcagtga
     2701 tgaggagtac gatgagtaca aaaggatcag ggaagaaaga aatggaaaat attccataga
     2761 ggaatacctc caggacagag acaagtatta tgaggaggtg gccatcgcca gggcgaccga
     2821 agaggacttc tgtgaagagg aagaggccaa gatccgacaa aggattttca ggccaacaag
     2881 gaaacaacgc aaagaggaga ggacctccct cggtttggtc acaggctctg aaatcaggaa
     2941 gaggaaccca gacgacttca aacctaaagg aaagctgtgg gctgatgacg acaggagtgt
     3001 tgaccacaat gagagactca attttgaagc cccgccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggct tttgggtttc ccccagcctg ttcataacat caacccatgt
     3121 cataccccag ggcgcacagg agttctttgg tgtccccatc aaacagattc agatacacaa
     3181 atcgggtgaa ttctgccgtt tgaggtttcc aaaaccgatc agaactgacg tgacaggcat
     3241 gatcttagaa gaaggtgcac ccgaagggac cgtggtcaca ttactcatca aaaggccaac
     3301 tggggaactc atgcccctgg cagccagaat gggaacccat gcaaccatga agattcaagg
     3361 gcgcactgtt ggaggtcaaa tgggcatgct cctaacagga tccaacgcta agagtatgga
     3421 cctaggcacc acaccaggtg actgtggctg tccctacatt tacaagaggg gaaatgacta
     3481 cgtagtcatt ggagttcaca cggctgccgc ccgtggagga aacactgtca tttgtgccac
     3541 ccaggggagc gagggagaag ccacacttga aggcggtgat agcaagggga cctactgcgg
     3601 tgcaccaatc ttaggtccag gaagtgcccc aaaactcagc accaagacta aattctggag
     3661 gtcgtccacg gcaccactcc cacctggtac ctatgagcca gcctacctcg gcggcaagga
     3721 ccccagagtt aagggtggcc cctcattaca acaagttatg agggaccaac tgaaaccatt
     3781 cactgagccc aggggcaaac caccaaagcc aagtgtgtta gaagctgcca agaaaaccat
     3841 cgtcaacgtc cttgaacaaa caattgatcc acctcaaaaa tggtcgtttg cacaagcttg
     3901 cgcttccctt gacaagacca cttccagcgg tcatccgcac catatgcgaa aaaatgactg
     3961 ttggaacggg gagtccttca caggaaaatt agcagaccag gcttccaagg ctaacctgat
     4021 gttcgaggag ggaaagaaca tgaccccagt ctacacgggt gcgcttaagg acgagctggt
     4081 caagactgac aagatttatg gcaagatcaa aaagaggctt ctctggggtt cggacctggc
     4141 gaccatgatc cggtgcgctc gggcattcgg aggcctgatg gaggaactca aagcacactg
     4201 tgtcacacta cccgtcagag tgggtatgaa tatgaatgag gatggtccta tcatctttga
     4261 gagacactcc agatataaat accattatga tgctgattac tcccggtggg actcaacaca
     4321 acaaagagcc gtgttggcag cagccttaga aatcatggtc aagttctccc cagaaccgca
     4381 cctggcccaa aaggttgcag aagaccttct ttctcccagc gtgatggacg tgggtgattt
     4441 caagatatca atcaatgagg gtctcccctc cggggtgccc tgcacctccc aatggaattc
     4501 catcgcccac tggctcctca ctctctgtgc actctctgag gtcacaaacc tgtcccctga
     4561 catcattcag gccaactctc tcttttcttt ctacggtgat gatgaaattg tgagtacaga
     4621 cataaagttg gacccagaaa aactgacagc aaaactcaag gaatacgggt tgaaaccaac
     4681 ccgccctgac aagactgaag gaccacttgt catctctgaa gacctgaatg gtctaacttt
     4741 cctgcggagg accgtgaccc gcgacccagc gggctggttt ggaaagttgg aacagagttc
     4801 aatacttaga caaatgtatt ggactagggg ccccaaccat gaagacccat ctgaaacaat
     4861 gataccacat tcccagaggc ccatacaatt gatgtctttg ctgggtgagg ctgcacttca
     4921 cggcccagca ttctatagca aaatcagtaa actggtcatt gcagagttga aggaaggtgg
     4981 catggatttt tacgtgccaa gacaagaacc aatgttcaga tggatgagat tctcggatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgctgc tccatctaat gatggtgctg ccggcctcgt cccagagatc agcagtgagg
     5161 caatggcgct agaaccagtg gcgggtgcag cgatagcagc acccctcact ggtcagcaga
     5221 atataattga tccctggatt atgaataatt ttgtgcaagc acctggtggt gagtttacag
     5281 tatctcctag aaattcccct ggtgaagttc ttctcaattt ggaattgggt ccagaaataa
     5341 atccctattt ggcccatctt gctagaatgt ataatggtta tgcaggtgga tttgaagtac
     5401 aggtggtcct agctggaaat gcgtttacag caggaaagat aatctttgca gctattcccc
     5461 ctaattttcc aattgataat ctaagtgcag cacagatcac aatgtgtcca catgtgattg
     5521 tggatgtcag gcagctggaa ccagtcaacc tcccgatgcc tgacgtccgc aataacttct
     5581 tccattacaa tcaagggtct gattcgagat tgcgcctaat tgcaatgcta tatacacctc
     5641 ttagggcaaa taattctggg gacgatgttt ttactgtgtc ttgcagagtg ctaactagac
     5701 ctagccctga cttctcattt aattttcttg tgccacccac tgtggagtca aagacaaaac
     5761 ccttttccct ccctattctg actatctccg aaatgtccaa ttctaggttc ccagtaccaa
     5821 ttgattcttt gcacaccagc cctactgaga acattgttgt ccagtgtcag aatgggcgag
     5881 tcacccttga tggtgagttg atgggcacca cccaactctt acctagccaa atctgtgctt
     5941 tcaggggcac gctcaccaga tcaacaagca gggccagtga ccaggctgat acagcaaccc
     6001 ctagattgtt taattattat tggcatatac aattggataa cctaaatgga actccttatg
     6061 accctgcaga agatatacca gcccccctag ggacaccaga tttccggggt aaagtctttg
     6121 gcgtggccag ccagagaaat cctgacgcca cgactagggc acatgaagca aagatagaca
     6181 caacatctgg ccgcttcacc ccaaaactag gttcactaga gatttccact gagtctggag
     6241 attttgacca aaaccaacca acaagattca ccccagttgg cattggggtt gaccatgagc
     6301 cagattttca acaatgggct cttcccgact atgcaggcca gttcacccac aacatgaact
     6361 tagccccagc tgttgctccc aacttccctg gtgagcagct ccttttcttc cgctcacagt
     6421 tgccatcttc tggtgggcgg tccaacggga ttctagactg cctggtcccc caagaatggg
     6481 tgcagcattt ctaccaagaa tcagccccct cccaaactca agtggcccta gttaggtatg
     6541 tcaaccctga cactggtaga gtgttatttg aggccaagtt gcacaaatta cgtttcatga
     6601 ctatagccaa gagtggtgac tccccaataa ctgtcccccc aaatggatac tttaggtttg
     6661 aatcttgggt gaaccccttt tatacacttg cccccatggg aactgggaat gggcgtagaa
     6721 ggattcaata atggctggag cttttatagc aggattggct ggtgatatgc tcacaaatac
     6781 tgtaggatct ttagttaatg caggggctaa tgccattaat caaacaattg attttgaaaa
     6841 taataaatat ttgcaaaatg cctcttttaa tcatgataag gagatgttga gtgcacaaat
     6901 tgaggcaaca aagaggttac aggctgacat gattgctatc aagcaagggg ttttgaccgc
     6961 tggcggcttc tcccctactg atgcagcccg cggggcaatt aatgccccca tgacaaaagt
     7021 cctagattgg aatggaacga gatactgggc accaggtgcc acctccacaa cctcgatgtc
     7081 gggtggcttc acgaatcaaa ctgcgcacag acccacacca aattttaaaa cgaaccaggc
     7141 ccccaaaccc acccccaaca gtgggtcctc agtgaggtca aattcaaccc aaattaccag
     7201 cctgagttca cactcgtccg ggtcgtctcg atccagcggg tctacagttg tcagctcaat
     7261 accatcctct aacaggacta gggactgggt taaccaacaa aattttaatt tggaaccaca
     7321 catgcctgga tctcttagaa cagcttttgt cactccacca tctagtacag cctctagctc
     7381 aggcacagtc tcaactgtgc ccaaaaatgt tttggactcc tggacatctg cgtttaatac
     7441 gcgcagacag ccgctattcg cacaccttcg cagaaggggg gagtcaaatg tttagtgaaa
     7501 aggttatttt aaatttggtt taagattgga tttaatttgg aatcttttaa aaaaaaaaaa
     7561 aaaaaaaaaa aaaaaaaa
//