Typing tool

Complete norovirus genomes

KC894943  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,556 | 3 CDS

ORF1: 3..5102
ORF2: 5083..6705
ORF3: 6705..7511
LOCUS       KC894943                7556 bp    RNA     linear   VRL 04-AUG-2013
DEFINITION  Norovirus Hu/GII.4/Guangzhou/GZ2010-L91/CHN/2011, complete genome.
ACCESSION   KC894943
VERSION     KC894943.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Guangzhou/GZ2010-L91/CHN/2011
  ORGANISM  Norovirus Hu/GII.4/Guangzhou/GZ2010-L91/CHN/2011
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7556)
  AUTHORS   Xue,L., Wu,Q., Kou,X. and Zhang,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-APR-2013) State Key Laboratory of Applied
            Microbiology (Ministry-Guangdong Province Jointly Breeding Base),
            South China, Guangdong Provincial Key Laboratory of Microbial
            Culture Collection and Application, Guangdong Open Laboratory of
            Applied Microbiology, Guangdong Institute of Microbiology, No. 100,
            Xianliezhong Road, Yuexiu District, Guangzhou, Guangdong 510070,
            China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: BioEdit v. 7.0.1
            Sequencing Technology :: 454
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7556
                     /organism="Norovirus
                     Hu/GII.4/Guangzhou/GZ2010-L91/CHN/2011"
                     /mol_type="genomic RNA"
                     /isolate="Hu/Guangzhou/GZ2010-L91/CHN/2011"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1379487"
                     /country="China"
                     /collection_date="14-Jan-2011"
                     /note="genotype: GII.4"
     CDS             3..5102
                     /note="ORF1; encodes NTPase, 3A-like protein, VPg,
                     Protease, and RdRp"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AGS16692.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSNMAVTLKRALGARP
                     KQPPPREIPQGPPRPTTPELVKKIPPPPPNGEDEVVVSYSAKGGVSGIPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLVLLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSSPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATNKDGC
                     PKPKDNEEFVISSDDIKAEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGRLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICAAQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIGPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGAPKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYNKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5083..6705
                     /note="ORF2; VP1"
                     /codon_start=1
                     /product="major viral capsid protein"
                     /protein_id="AGS16693.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPNYSGSDVPNVHLAPAVAPNFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6705..7511
                     /note="ORF3; VP2"
                     /codon_start=1
                     /product="minor viral capsid protein"
                     /protein_id="AGS16694.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAVLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSAPQPSGVLPGRANPRAPTPARGSPNTSS
                     SASTATSIYSNQTVSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 gaatgaagat ggcgtctaac gacgcttccg ctgccgctgt tgctaacagc aacaacgaca
       61 ccgcaaaatc ttcaagtgac aaaatgtttt ctaacatggc tgtcaccctc aaacgagccc
      121 tcggggcgcg gcctaaacag ccccccccga gggaaatacc acaaggaccc ccacgaccaa
      181 ctactccaga actggtcaaa aagatccctc cccccccgcc caacggagag gacgaagtag
      241 tggtttctta tagtgccaaa ggtggtgttt ccggtatacc tgagctttcc accgtcaggc
      301 aaccggaaga aaccaatacg gctttcagtg tccctcccct caatcagagg gagaataggg
      361 atgctaagga gccactgact ggaacaattt tggaaatgtg ggatggagaa atctaccatt
      421 atggcctgta tgttgagcga ggtcttgtgc tgggtgtgca caaaccacca gctgccatta
      481 gcctcgccaa ggtcgaacta acaccactct ccttgttctg gagacctgtg tacactcctc
      541 agtacctcat ctctccagac actctcaaga aattacacgg agaaacattt ccctacacag
      601 ccttcgacaa caattgctat gccttctgtt gctgggtcct ggatctaaac gactcgtggc
      661 tgagtaggag aatgatccag agaacaactg gcttcttcag accctaccaa gattggaata
      721 ggaaacccct ccccactatg gatgattcca aattaaagaa ggtagctaac atattcctgt
      781 gcaccctgtc ttcgctattc accaggccca taaaagacat aatagggaag ttaaggcctc
      841 tcaacatcat caacatcctg gcttcatgtg attggacttt cgcaggcata gtggaatcct
      901 tggtactctt ggcagaactc tttggagtct tctggacacc cccagatgtg tctgcgatga
      961 ttgccccctt actcggtgat ttcgagttac aagggcctga ggaccttgta gtggagctcg
     1021 tccctgtagt aatgggggga attggtttgg tgctaggatt caccaaggag aagattggaa
     1081 aaatgttgtc atctgctgca tccaccttaa gagcttgtaa agatcttggt gcgtatgggc
     1141 tagagatcct aaagttagtc atgaagtggt tcttcccgaa gaaagaggaa gcaaatgaac
     1201 tggctatggt gagatccatc gaggatgcag tgctagacct tgaggcaatt gaaaacaacc
     1261 acatgaccac cttgctcaaa gacaaagaca gcctggcaac ctatatgaga acccttgacc
     1321 tcgaggaaga gaaagccaga aaactctcaa ccaagtctgc ttcacctgac atcgtgggca
     1381 caatcaacgc ccttctggcg agaatcgccg ctgcacgctc cctggtgcac cgagcgaagg
     1441 aggagctttc tagcagacca agacctgtag tcttgatgat atcaggcaga ccaggaatag
     1501 ggaagaccca ccttgctagg gaagtggcta agagaatcgc agcttccctc acaggagacc
     1561 agcgtgtagg cctcatccca cgcaatggcg tcgatcactg ggatgcgtac aagggggaga
     1621 gggtcgtcct atgggacgac tatggaatga gcagtcccat ccacgacgcc ctcaggctgc
     1681 aagaactcgc tgacacttgc cccctcactc taaactgtga caggattgag aataaaggaa
     1741 aggtctttga cagcgatgtc atcattatca ctactaacct ggccaaccca gcaccactgg
     1801 actatgtcaa ctttgaagcg tgctcgaggc gcattgattt cctcgtgtat gcagaagccc
     1861 ccgaggtcga aaaggcgaag cgtgacttcc caggccagcc tgacatgtgg aaaaacgctt
     1921 ttagttctga tttctcacac ataaaattgg cactggctcc acaaggtggc tttgataaga
     1981 acgggaacac cccgcatggg aagggcgtca tgaagactct caccactggc tccctcattg
     2041 cccgggcatc agggctgctc catgagagat tggatgagtt tgaactacag ggcccagctc
     2101 ttaccacctt caactttgac cgcaacaaag tgcttgcctt caggcagctt gctgctgaaa
     2161 ataaatacgg gttgatggac acaatgaaag ttgggaggca gctcaaggat gtcaaaacca
     2221 tgccagaact taaacaagca ctcaagaata tctcaatcaa gaagtgccag attgtgtata
     2281 gtggttgcac ctacacactt gagtctgatg gcaagggcaa tgtgaaagtt gacagagttc
     2341 agagcacctc cgttcagacc aacaatgagc tggctggcgc cctgcaccac ctaaggtgcg
     2401 ccagaatcag gtactatgtc aagtgtgttc aggaggccct gtattctatc atccagattg
     2461 ctggggctgc atttgtcacc acgcgcatca tcaagcgtgt gaacattcaa gacttatggt
     2521 ccaagccaca agtggaaaac acagaggagg ccaccaacaa ggacgggtgc ccaaaaccca
     2581 aagataatga ggagttcgtc atttcatctg acgacattaa agctgaaggt aagaaaggga
     2641 agaacaagac tggccgtggc aagaaacaca cagccttttc aagtaaaggt ctcagtgatg
     2701 aagagtatga tgagtacaag agaattagag aggaaaggaa tggtaagtac tccatagaag
     2761 agtatcttca ggacagggat aaatactatg aggaggtggc cattgccagg gcgaccgagg
     2821 aagacttctg tgaagaggag gaggccaaga tccggcaaag gatcttcaga ccaacaagga
     2881 aacaacgcaa ggaagaaaga gcttctctcg gtttagtcac aggttctgaa attaggaaaa
     2941 ggaacccaga cgacttcaag cctaagggga gactatgggc tgacgatgac agaagtgtgg
     3001 actacaatga aaaactcagc tttgaggccc caccaagcat ctggtcaagg atagtcaact
     3061 ttggctcagg ttggggcttc tgggtctccc ccagcctgtt tataacgtca acccacgtca
     3121 taccccaggg cgcaaaggag ttctttggag tccccatcaa acaaattcag gtacacaagt
     3181 caggcgaatt ctgtcgctta aggttcccaa aaccaatcag gactgatgtg actggcatga
     3241 tcctggaaga aggcgcgccc gaaggcaccg tggtcacact actcatcaaa aggtctactg
     3301 gagaactcat gcccttagca gctagaatgg ggacccatgc aaccatgaaa attcaagggc
     3361 gcactgttgg gggtcagatg ggcatgcttc tgacaggatc caacgccaaa agcatggatc
     3421 taggcaccac accaggtgat tgcggctgtc cctacatcta caagagagga aatgactatg
     3481 tggtcattgg agtccacacg gctgccgctc gtgggggaaa cactgtcata tgtgccgccc
     3541 aggggggtga gggggaagct acacttgaag gtggtgacag taagggaaca tactgtggcg
     3601 caccaatcct aggcccaggg agtgccccaa aacttagcac caaaaccaaa ttctggagat
     3661 catccacagc accactccca cctggcacct atgaaccagc ctaccttggt ggcaaggacc
     3721 ccagagtcaa gggtggcccc tcgttgcagc aagttatgag ggaccagctg aaaccattta
     3781 cagagcctag gggtaaacca ccaaagccaa gtgtgttaga agctgccaag aaaaccatca
     3841 tcaatgtcct tgaacaaaca attggcccac ctgagaagtg gtcgttcgca caagcctgcg
     3901 cgtcccttga caagaccact tctagcggcc atccacacca catgcggaaa aacgactgct
     3961 ggaacgggga atctttcaca ggcaagctgg cggaccaggc ttccaaggcc aacctgatgt
     4021 ttgaagaagg gaagaacatg actccggtct acacaggtgc acctaaggat gaattagtca
     4081 aaactgacaa aatttatggt aagatcaaga agaggctact ctggggctcg gatttggcaa
     4141 ccatgatccg gtgtgctcga gcattcggag gcctaatgga tgaactcaaa gcacactgtg
     4201 tcacactccc tatcagagtt ggtatgaata tgaatgagga tggccccatc atctttgaga
     4261 agcattccag gtacagatac cactatgatg ctgattactc tcggtgggat tcaacacaac
     4321 agagagccgt gctggcagct gctctagaaa tcatggtcaa attctcctca gaaccacatt
     4381 tggctcaggt agtagcagaa gaccttcttt ctcctagcgt ggtggacgtg ggggacttca
     4441 caatatcaat caacgagggt cttccctctg gggtgccctg cacctcccaa tggaactcca
     4501 tcgcccactg gcttctcact ctctgtgcac tctccgaagt tacaaatttg tccccagaca
     4561 tcatacaggc taattctctc ttctccttct atggtgatga tgaaattgtt agtacggaca
     4621 taaaattaga cccagaaaag ttgacagcaa agcttaagga atacgggttg aaaccaaccc
     4681 gccccgataa aactgaagga cctcttgtta tttctgaaga cttagatggc ttgaccttcc
     4741 tgcggagaac tgtgacccgc gacccagctg gttggtttgg aaaactggag cagagctcaa
     4801 tactcaggca aatgtactgg actaggggcc ctaaccatga agatccatct gaatcaatga
     4861 ttccacactc tcaaagaccc atacaattga tgtccttact gggagaggcc gcactccacg
     4921 gcccaacatt ctacaacaaa atcagcaaat tagtcattgc agagttaaaa gaaggtggta
     4981 tggattttta cgtgcccagg caagagccaa tgttcagatg gatgagattc tcagatctga
     5041 gcacgtggga gggcgatcgc aatctggctc ccagttttgt gaatgaagat ggcgtcgaat
     5101 gacgccaacc catctgatgg gtccgcagcc aacctcgtcc cagaggtcaa caatgaggtt
     5161 atggctttgg agcccgttgt cggtgccgct attgcggcgc ctgtagcggg ccaacaaaat
     5221 gtaattgacc cctggattag gaataatttt gtacaagccc ctggtggaga gttcacagta
     5281 tcccctagaa acgctccagg tgaaatacta tggagcgcac ccttaggccc tgatctgaat
     5341 ccctacctat ctcatttggc cagaatgtat aatggttatg caggtggttt tgaagtgcag
     5401 gtgatcctcg cggggaacgc gttcaccgcc ggaaaaatta tatttgcagc agtcccacca
     5461 aattttccaa ctgaaggctt gagtcccagc caggtcacta tgttccccca cataatagtg
     5521 gatgttaggc aattggaacc tgtgttgatc cccttacctg atgttaggaa taacttctat
     5581 cactataatc aatcaaatga ttctaccatt aagttgatag caatgctgta tacaccactt
     5641 agggctaata atgctgggga agatgtcttc acagtctctt gtcgagtcct cacgaggcca
     5701 tcccctgatt ttgatttcat atttttggtg ccacctacag ttgagtcaag aactaaacca
     5761 tttactgtcc caatcttgac tgttgaggaa atgaccaatt caagattccc cattcctttg
     5821 gaaaagttgt tcacgggtcc cagcagtgcc tttgttgttc aaccacaaaa tggcagatgc
     5881 acgactgatg gcgtgctctt aggcaccacc caactgtctc ctgtcaacat ctgcaccttc
     5941 agaggggatg tcacccacat tgcaggttct cgtaattaca caatgaattt ggcttctcta
     6001 aattggaaca attatgaccc aacagaagaa attccagctc ctctaggaac tccagatttc
     6061 gtgggaaaga tccaaggtgt gctcactcaa accactaagg gggatggttc gacccgtggc
     6121 cataaagcta cagtttacac tgggagtgcc ccctttactc caaagctggg cagtgttcaa
     6181 ttcagtactg atacagaaaa tgattttgaa actcaccaaa acacaaaatt caccccagtc
     6241 ggtgtcatcc aggatggtgg caccacccac cgaaatgaac cccaacaatg ggtgctccca
     6301 aattattcag gtagtgatgt ccctaatgta cacctagccc ctgctgtagc ccccaatttc
     6361 ccgggtgaac aacttctttt ctttaggtct actatgcccg gatgcagcgg gtatcccaac
     6421 atggatttgg attgcctact cccccaggag tgggtgcagc acttctacca agaggcagct
     6481 ccagcacaat ctgatgtggc tctattgaga tttgtgaatc cagacacggg tagggtcctg
     6541 tttgaatgta aactccataa atcaggctat gtcacagtgg ctcacaccgg ccagcatgat
     6601 ttggtcatcc cccccaatgg ttattttagg tttgattcct gggttaatca attctacaca
     6661 cttgccccca tgggaaatgg aacggggcgc agacgtgctt tataatggct ggagctttct
     6721 ttgctggatt ggcatctgat gtccttagct ctggacttgg ttccctaatc aatgctgggg
     6781 ctggggctat taaccaaaag attgattttg aaaataacag aaaattgcag caagcttcct
     6841 tccagtttag cagtaatctg caacaggctt cctttcaaca tgataaagaa atgctccaag
     6901 cacaaattga agccactaaa aagttgcaac aggaaatgat gaaagtcaaa caggcagtgc
     6961 tcttagaagg tggattctct gaaacagatg cagcccgtgg ggcaatcaac gcccctatga
     7021 caaaggctct ggactggagc ggaacaaggt actgggcccc tgatgctagg actacaacat
     7081 acaacgcagg ccgcttttcc gcccctcaac cttcgggggt actgccagga agagccaatc
     7141 ccagggctcc tacccccgct cggggctccc ccaacacatc ttctagtgct tctactgcta
     7201 cttctatata ttcaaatcaa actgtttcaa cgagacttgg ttctacagct ggttctggca
     7261 ccagtgtctc gagtctcccg tcaactgcaa ggactaggag ttgggttgag gatcaaaaca
     7321 gaaatttgtc acctttcatg aggggggctc acaacatatc gtttgtcacc ccaccatcta
     7381 gcagatcctc tagccaaggc acagtctcaa ccgtgcctaa agaagttttg gactcctgga
     7441 ctggcgcttt caacacgcgc aggcagcctc tcttcgctca cattcgtagg cgaggggagt
     7501 cacgggtgta atgtgaaaag acaaaattga ttatctttcc tttctttagt gtcttt
//