Typing tool

Complete norovirus genomes

KC662537  GII.13
 GII.P12

Length: 7,492 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6713
ORF3: 6713..7447
LOCUS       KC662537                7492 bp    RNA     linear   VRL 25-MAY-2013
DEFINITION  Norovirus Hu/GII/Hy-718/KOR, complete genome.
ACCESSION   KC662537
VERSION     KC662537.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII/Hy-718/KOR
  ORGANISM  Norovirus Hu/GII/Hy-718/KOR
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7492)
  AUTHORS   Won,Y.-J. and Paik,S.-Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-FEB-2013) Department of Microbiology, College of
            Medicine, The Catholic University of Korea, 505 Banpo-dong,
            Seocho-gu, Seoul 137-701, Korea
FEATURES             Location/Qualifiers
     source          1..7492
                     /organism="Norovirus Hu/GII/Hy-718/KOR"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII/Hy-718/KOR"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1335448"
                     /country="South Korea"
                     /note="genotype: GII"
     gene            5..5104
                     /gene="ORF1"
     CDS             5..5104
                     /gene="ORF1"
                     /note="contains helicase, VPg, 3Cpro, and RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AGL96586.1"
                     /translation="MKMASNDASAAAAANSNNDIAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEPVVSYSVKDGVSGLPELITVRQPD
                     EVNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHRPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANVFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGEYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGRQLKDVRTM
                     PELKQALKNISIKRCQIVYSGCTYTLESDGKGDVKVDRVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEETASKDGC
                     PEPKDDEEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERINFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPHGAQEFFGVSIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMYEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDVKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPALYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5085..6713
                     /gene="ORF2"
     CDS             5085..6713
                     /gene="ORF2"
                     /note="contains N/S domain and P domain"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="AGL96587.1"
                     /translation="MKMASNDAAPSNDGAASLVPEGINETMPLEPVAGASIAAPVAGQ
                     TNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILLNLELGPDLNPYLAHLPRMYNGYAGG
                     VEVQVLLAGNAFTAGKILFAAIPPNFPVDMISPAQITMLPHLIVDVRTLEPIMIPLPD
                     VRNVFYHFNNQPQPRMRLVAMLYTPLRSNGSGDDVLTVSCRVLTRPTPDFEFIYLVPP
                     SVESKTKPFTLPILTISELTNSRFPIPIEQLYTAPNETNVVQCQNGRCTLDGELQGTT
                     QLLSSAVCSYRGRTVANNGDNWDQNLLQLTYPNGASYDPTDEVPAPLGTQDFSGMLYG
                     VLTQDNVNVSTGEAKNAKGIYISTTSGKFTPKIGSIGLHSITEHVHPNQQSRFTPVGV
                     AVNENTPFQQWVLPHYAGSTRSHTNLGTALAPTFPGEQLLFFRSRVPCVQGLQGQDAF
                     IDCLLPQEWVNHFYQEAAPSQADVALIRYVNPDTGRTLFEAKLHRSGFITVSHTGAYP
                     LVVPPNGHFRFDSWVNQFYSLAPMGTGNGRRRIQ"
     gene            6713..7447
                     /gene="ORF3"
     CDS             6713..7447
                     /gene="ORF3"
                     /codon_start=1
                     /product="ORF3"
                     /protein_id="AGL96588.1"
                     /translation="MAGAFIAGLAGDMLTSAVGSLTSAGANAINQKLNFDYNKQLQNA
                     SFQHDKEMLQAQIDATKKLQSEMIAIKHGVLTAGGFSPADAARGAVNAPMTRVLDWSG
                     TRYYAPNSVQTTSYSGQFTPSPVHRVQVKSSSNSSQRTAAPSSIRSLSTQSTSVTGST
                     SLGGPSETSSSSRTADWVRQQRALSPYMHGALRTAYVTPPSSRASSVSSVSTVPKGVL
                     DSWTPVFNTRRQPLFAHLRKRGESQV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgccaaca gcaacaacga
       61 catcgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcctccccc gagggaaata ccacagagac ccccacgacc
      181 acccacacca gaactggtca aaaagatccc tcctcccccg cccaacgggg aggatgaacc
      241 agtggtttct tatagcgtca aagatggtgt ttccggcttg cctgagctta tcactgtcag
      301 gcagccggac gaagtcaaca cggcgttcag tgttccccca ctcaaccaaa gggagaatag
      361 ggacgccaag gaaccactaa ctggaacaat tctggaaatg tgggacgggg agatctacca
      421 ttacggcctg tatgtggaac gaggtctagt acttggcgtg cacagaccac ctgctgccat
      481 cagccttgcc aaggttgaac taacaccact ctctctgttt tggaggccag tgtacacacc
      541 tcagtatctc atttctccag acactcttag gaggctgcac ggagaatcgt tcccctatac
      601 ggcctttgac aacaattgct atgccttctg ttgttgggtc ctggacctaa acgactcgtg
      661 gttgtgtagg agaatgatcc agaggacaac tggtttcttt aggccctacc aagactggaa
      721 taggaaaccc cttcctacta tggatgattc caagttgaag aaggtagcta acgtattcct
      781 gtgcgcgctt tcttcactat tcaccaggcc catcaaagac ataataggga agctgagacc
      841 tcttaacatc cttaacatct tggcctcatg tgattggact tttgcaggca tagtggaatc
      901 cttgatactc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttactgggtg aatacgagct gcaggggcct gaggaccttg cagtggaact
     1021 cgtcccaata gtgatggggg ggattggttt ggtgctagga tttaccaaag agaagattgg
     1081 gaaaatgttg tcatctgctg catccacctt aagagcttgc aaagaccttg gtgcatacgg
     1141 gctggaaatc ttgaaattag tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 gctggctatg gtgagatcca tcgaggacgc ggtgctggac ctcgaggcaa ttgagaacaa
     1261 ccacatgact gcccttctta aagacaaaga tagcttggca acctatatga gaaccctcga
     1321 cctcgaggag gagaaggcca ggaagctctc aaccaagtct gcttcacctg acatcgtggg
     1381 tacaatcaat gctcttctgg cgagaatcgc cgctgcgcgc tccctggtgc atcgggcgaa
     1441 ggaggagctc tctagcagac caagacctgt tgttgtgatg atatcaggca gaccagggat
     1501 agggaaaacc caccttgcca gggaattggc caagagaatt gcagcttccc tcacagggga
     1561 ccagcgtgtg ggtctcatcc ctcgcaatgg cgttgaccat tgggacgcat acaagggaga
     1621 aagagtcgtc ctgtgggacg attatggaat gagtaatccc atccatgatg ccctcagatt
     1681 gcaagaactt gctgacacct gccccctcac gctaaattgt gacaggattg agaataaagg
     1741 aaaggtattt gacagtgatg ccataatcat caccactaac ctggccaacc cagcaccact
     1801 ggactatgtt aactttgaag catgctcgag gcgcattgac ttcctcgtgt atgcagatgc
     1861 ccctgaggtc gaaaaggcaa aacgtgactt cccaggtcaa cctgacatgt ggaagaacgc
     1921 ttttagtcct gacttctcgc acataaaact gacgctggct ccgcagggag gtttcgacaa
     1981 gaacggaaac accccacatg ggaaaggcgt catgaaaact ctcaccactg gctctctcat
     2041 cgcccgagca tcagggctac tccatgagag gttggatgag tacgagctgc agggcccaac
     2101 ccccaccacc ttcaacttcg accgcaacaa ggtgcttgct tttagacagc ttgctgctga
     2161 aaacaagtac gggttaatgg acacaatgag agttggtaga caactcaagg atgtcaggac
     2221 tatgccagag ctcaaacagg cactcaagaa tatctcaatc aagaggtgtc agatagtgta
     2281 cagtggctgc acctacacgc ttgaatctga tggcaagggt gacgtgaaag ttgatagagt
     2341 tcagagcgcc actgtgcaga ccaacaatga gctggctggc gccctacacc atctaaggtg
     2401 tgccagaatt agatactatg tcaagtgtgt tcaggaggcc ctgtactcca tcatccaaat
     2461 tgctggtgct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aagatctttg
     2521 gtccaaacca caggttgaag atacagagga gaccgctagc aaggatgggt gcccagaacc
     2581 caaagatgat gaagagtttg tcgtctcatc cgacgacatc aaaactgagg gcaagaaagg
     2641 gaagaacaaa tctggccgtg gcaagaagca tacagcattc tcaagtaaag gtctcagtga
     2701 tgaagagtac gatgagtaca agagaatcag agaagaaaga aacggcaaat actccataga
     2761 agagtacctt caggacagag acaagtatta tgaggaggtg gccatcgcca gggcgaccga
     2821 agaggacttc tgtgaggaag aagaagccaa gatccgacaa aggatcttca ggccaacaag
     2881 gaaacaacgc aaggaggaga gagcctctct cggcctggtc acaggctctg aaatcagaaa
     2941 aagaaaccca gacgatttca agcctaaagg gaagctgtgg gctgatgacg acaggagtgt
     3001 tgactacaac gagagaatca attttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggctca ggttggggct tttgggtctc ccccagtctg ttcataacat caactcatgt
     3121 cataccccat ggcgcacagg agttctttgg ggtttctatc aaacagattc agatacacaa
     3181 atcgggtgaa ttctgtcgct tgaggtttcc aaaaccaatc aggactgacg tgacaggcat
     3241 gatcttggaa gaaggtgcgc ccgaagggac cgtggccaca ttactcatca agaggccaac
     3301 tggagaactc atgcccttgg cggccagaat gggaacccat gcaaccatga agatccaagg
     3361 gcgcaccgtt ggaggtcaaa tgggcatgct tctaacagga tccaacgcca agagtatgga
     3421 tctgggcacc acaccgggtg actgtggttg tccctacatt tacaagaggg ggaatgacta
     3481 cgtagtcatt ggagtccaca cggctgccgc ccgtggagga aacactgtca tatgtgccac
     3541 ccaggggagt gagggagaag ccacacttga aggtggtgac aacaagggaa cctactgtgg
     3601 tgcaccgatc ttaggtccag gtagtgcccc aaaactcagt accaagacta aattttggag
     3661 atcatccaca gcaccactcc cacctggtac ctatgaacca gcctaccttg gcggcaaaga
     3721 ccccagagtc aagggtggtc cttcattgca acaagttatg agggaccagc tgaaaccatt
     3781 tactgaaccc aggggcaaac caccaaaacc aagtgtgtta gaggctgcca agaaaaccat
     3841 catcaatgtc cttgagcaaa caattgatcc accccaaaaa tggtcattcg cgcaagcatg
     3901 cgcgtccctc gacaagacca cctctagtgg ccacccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca caggcaaatt ggcagaccag gcttccaagg ctaacctgat
     4021 gtacgaagag ggaaagaaca tgactccagt ttacacgggt gcgcttaagg acgagctggt
     4081 caagactgac aaaatttatg gcaaaatcaa aaagaggctt ctctggggct cggacctggc
     4141 gaccatgatc cggtgtgctc gggcttttgg gggcctgatg gatgaactta aagcacattg
     4201 tgtcacactc cccgtcagag tgggtatgaa tatgaatgag gatggtccta tcatctttga
     4261 aagacattcc agatacaaat atcactatga tgctgattac tctcggtggg actcaacaca
     4321 acagcgggcc gtactagcag cagccttaga aatcatggtt aagttctccc cagaacctca
     4381 tctggcccaa aaggttgcag aagaccttct ctctcccagc gtgatggatg taggtgattt
     4441 caaaatatca attaatgagg gcctcccctc tggggtaccc tgcacctccc aatggaattc
     4501 catcgcccac tggctcctca ccctctgtgc actttctgag gtcacaaacc tgtcccctga
     4561 cattatccag gccaattccc tcttctcctt ctatggtgat gatgaaattg tgagcacaga
     4621 cgtaaagctg gacccagaga agctgacagc aaaactcaag gaatacgggc tgaaaccaac
     4681 ccgccctgac aagactgagg ggccccttgt tatctctgag gacctgaatg gcttgacttt
     4741 cctgcggagg actgtaaccc gcgatccagc tggctggttt ggaaaactgg aacagagttc
     4801 aatacttagg caaatgtact ggactagggg ccctaatcat gaagacccat ctgaaacaat
     4861 gataccacac tcccaaagac ccatacaatt aatgtctttg ctgggcgagg ctgccctcca
     4921 cggcccagcg ctctacagca aaatcagcaa gttagttatt gcagaactaa aggaaggtgg
     4981 catggatttc tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccgc tccatcaaat gatggtgcag ctagtctcgt accagagggc attaatgaga
     5161 ctatgccatt ggaacccgtt gctggtgcat ctattgctgc cccagtggcg ggacaaacca
     5221 acataattga cccctggata agaacaaatt ttgtacaagc ccctaatgga gagtttacag
     5281 tgtcaccaag aaattcccct ggagaaattt tattaaattt agaattagga ccagatctga
     5341 atccttattt ggcccatctt cctagaatgt ataatggtta tgctggaggt gttgaggtgc
     5401 aagtgctcct cgctgggaac gcgttcacag caggtaagat attgtttgca gcaatcccac
     5461 ctaactttcc tgtagatatg attagcccag ctcaaattac tatgcttccc catttgattg
     5521 tagatgttag aactttggaa cctattatga tacccttgcc tgatgttagg aatgtgttct
     5581 atcattttaa taatcaacct caacctagaa tgagattagt ggctatgctt tataccccct
     5641 tgaggtctaa tggttcaggg gatgatgtcc tcactgtgtc ttgtagagtg ctaactaggc
     5701 caactcctga ttttgaattt atctatctgg tgcccccttc tgtagagtcc aaaactaaac
     5761 cattcacact accaatatta accatttctg aattgaccaa ctcccggttc cctattccaa
     5821 tcgagcaatt gtatacggct ccaaatgaga ccaatgttgt ccagtgtcag aatggcagat
     5881 gcaccttaga tggagagctc cagggcacaa cccagctgtt gtcaagtgca gtttgctctt
     5941 acaggggcag gactgtggcc aataatgggg ataattggga tcaaaatttg ctccagctga
     6001 cctatccaaa tggtgcaagc tatgacccca ctgatgaagt gccggcacca ttgggcactc
     6061 aagattttag tgggatgttg tatggagtgt tgacccagga caatgtgaat gtgagcacag
     6121 gagaggccaa aaatgctaag gggatataca tatccaccac tagtgggaaa ttcaccccaa
     6181 aaattgggtc aattggattg cattcaataa ctgagcacgt gcaccccaac caacagtcgc
     6241 ggttcacccc cgttggagtc gccgtgaatg agaacacccc ctttcagcaa tgggttctgc
     6301 cacattatgc aggtagtact cgctctcata ccaatttggg cactgctctt gccccgactt
     6361 tccctggtga gcaattgctg ttcttcaggt cccgtgtccc atgtgtccaa ggcctacagg
     6421 ggcaggatgc gttcatagat tgcctcctgc cccaagagtg ggtgaatcat ttttaccaag
     6481 aggcagcccc ttcccaagca gacgtcgccc ttattaggta tgtcaaccct gatactggtc
     6541 gtacgctgtt tgaagccaag ttgcatagat caggtttcat cactgtgtca catactggtg
     6601 cttaccctct tgtagtcccc ccaaatggtc attttaggtt tgattcttgg gttaatcaat
     6661 tttactcact cgcccccatg ggaactggta atgggcgtag aagaatccag taatggcagg
     6721 agcatttata gctggtttgg ccggtgacat gctgacttct gctgttggtt cactgacctc
     6781 tgcaggagcc aatgccatca atcagaaatt gaattttgat tacaacaaac aactccaaaa
     6841 tgcatccttc cagcatgata aggaaatgtt gcaggctcaa attgatgcca caaagaaact
     6901 tcaatctgaa atgattgcaa tcaagcatgg ggttttgacc gcgggcggct tttccccagc
     6961 tgatgcagct agaggggcag tcaatgcccc aatgactaga gtgctggatt ggtcagggac
     7021 acgttactat gctccaaatt ctgtgcaaac tactagctat tctggacaat tcaccccctc
     7081 gccagtccac cgggtgcagg tgaaatcttc ttctaattca tctcagcgga ccgcagctcc
     7141 aagcagcatc cgtagtctgt caactcaatc aacttctgta acaggctcta cctccctagg
     7201 ggggccctct gaaacctcct ctagctctag aacagcagac tgggtacggc aacagagggc
     7261 tcttagcccg tacatgcatg gagccctgcg gacggcatat gtcacaccgc cgtcaagcag
     7321 ggcctccagt gtgagctctg tctcaacagt gcccaaaggg gttttggact cctggacacc
     7381 tgtgtttaac acacgcaggc agccgctatt tgcacacctc aggaagaggg gggagtcaca
     7441 agtttagtga aaaggataat caatgtttaa atgtgatttt attttccttg ca
//