Typing tool

Complete norovirus genomes

KC577174  GII.4 New Orleans
 GII.P4 New Orleans

Length: 7,548 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       KC577174                7548 bp    RNA     linear   VRL 11-DEC-2013
DEFINITION  Norovirus Hu/GII.4/Jiangsu1/2011/CHN, complete genome.
ACCESSION   KC577174
VERSION     KC577174.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Jiangsu1/2011/CHN
  ORGANISM  Norovirus Hu/GII.4/Jiangsu1/2011/CHN
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7548)
  AUTHORS   Fu,J.G., Ai,J., Qi,X., Zhang,J., Tang,F.Y. and Zhu,Y.F.
  TITLE     Emergence of two novel norovirus genotype II.4 variants associated
            with viral gastroenteritis in China
  JOURNAL   J. Med. Virol. (2013) In press
   PUBMED   24136475
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 7548)
  AUTHORS   Fu,J., Qi,X., Zhu,Y., Zhou,M., Pan,Y. and Ai,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2013) Key Lab of Enteric Pathogenic Microbiology,
            Ministry of Health, Jiangsu Provincial Center of Disease Control
            and Prevention, Jiangsu Road 172, Nanjing, Jiangsu 210009, China
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7548
                     /organism="Norovirus Hu/GII.4/Jiangsu1/2011/CHN"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Jiangsu1/2011/CHN"
                     /host="Homo sapiens"
                     /db_xref="taxon:1432852"
                     /country="China"
                     /collection_date="Oct-2011"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AHB62403.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREKPQRPPRPPTPELVRNIPPPPPNGEDEIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELAPLSLYWRPVYTPQYLISPDTLKKLSGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKIKKVANIFLCALSSLFTRPIKDIIGK
                     IRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLIDTMRVGKQLKNVRTM
                     PELKQALKDVSIKKCQIVYSGCTYILESDGKGNVKVDRIQSAAVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRITKRMNIQDLWSKPQVENTEETTSKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGTEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPTLSTKTKFWRSSTASLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHGDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="AHB62404.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHISGSSNYTMNLASQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFSPKLGRVQFATDTDNDFETNQNTKFTPVGVIQDG
                     ATTHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="AHB62405.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKTLDWSGTRYWAPDARTTTYNAGRFSTPQPSGAPPGRANLRATVPARGSSSTSS
                     NSSIATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
     3'UTR           7514..7548
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaaca gcaataacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt tcaaacgagc
      121 cctcggggcg cggcctaaac agcctccccc gagggaaaaa ccacaaagac ccccacgacc
      181 acctactcca gaactggtta ggaatattcc ccctccccca cccaacgggg aggatgaaat
      241 agtggtttct tatagtgtca aagatggtgt ttccggcttg cctgaccttt ccaccgtcag
      301 gcaaccggaa gaatctaaca cggccttcag tgtccctcca ctcaatcaga gggagaatag
      361 agatgctaag gagccactta ctggaacaat tctggaaatg tgggacgggg aaatctacca
      421 ttatggcctg tatgtggagc gaggtcttgt actaggtgtg cacaaaccac cagctgccat
      481 cagcctcgct aaggttgagc tagcaccact ctccttgtac tggagacctg tgtacactcc
      541 tcagtacctc atctctccag acactctcaa gaaattatcc ggagaaacgt tcccctacac
      601 agcctttgac aacaactgtt atgccttttg ttgctgggtc ctggacctaa atgactcgtg
      661 gctgagcagg agaatgatcc agagaacaac tggtttcttc aggccctacc aagattggaa
      721 taggaaaccc cttcccacta tggatgactc caaaataaag aaggtagcta acatattcct
      781 gtgtgctctg tcctcgctgt tcaccagacc cataaaagat ataataggga agataaggcc
      841 tcttaacatc ctcaacatct tagcctcatg tgattggact tttgcaggca tagtggagtc
      901 cctgatactc ttggcagaac tctttggagt cttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttgcttggtg actacgagct acaaggacct gaggaccttg cagtagagct
     1021 cgtccccgtg gtgatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 gaaaatgttg tcatctgctg cgtccacctt gagagcttgt aaagaccttg gtgcatatgg
     1141 gctagagatc ctaaagttgg tcatgaagtg gttcttcccg aagaaggagg aggcaaatga
     1201 gctggctata gtgaggtcta tcgaggatgc agtcctggat ctcgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagcctggca acctatatga gaacacttga
     1321 ccttgaggag gagaaagcca ggaaactctc aaccaagtct gcctcacccg acatcgtggg
     1381 cacaatcaac gccctcctgg cgagaatcgc tgccgcacgt tctctggtgc atcgagcgaa
     1441 ggaagagctt tccagcagac caaggcctgt ggtgttgatg atatcaggca ggccaggaat
     1501 agggaagacc cacctcgcta gggaagtggc taagagaatc gcagcctccc ttacaggaga
     1561 ccagcgtgtg ggcctcatcc cacgcaatgg cgtcgaccat tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg attatggaat gagcaaccct attcacgatg ccctcaggct
     1681 gcaagaactc gctgacactt gtccccttac tctaaactgt gacaggattg aaaataaagg
     1741 aaaggtcttt gacagtgatg tcatcattat caccactaat ctggccaacc cagcaccact
     1801 ggactatgtc aactttgaag catgctcgag gcgtatcgat ttcctcgtgt atgcagaagc
     1861 ccctgaagtc gaaaaggcga agcgtgattt cccaggccag cctgacatgt ggaagaacgc
     1921 tttcagtcct gatttctcac acataaaact agcactggcc ccacagggtg gtttcgacaa
     1981 gaacgggaac accccacacg gaaagggcgt catgaagact ctcaccactg gctcccttat
     2041 tgcccgggca tcagggctac tccatgagag gttagatgaa tttgaactac agggcccagc
     2101 tctcaccacc ttcaatttcg atcgcaataa agtgctcgcc tttagacagc tagctgctga
     2161 aaacaaatat gggttgatag acacaatgag agttgggaaa cagctcaaga atgtcagaac
     2221 catgccagaa ctcaaacaag cactcaagga tgtctcaatc aagaagtgcc aaatagtgta
     2281 tagtggttgc acctacatac ttgagtctga tggcaagggc aatgtgaaag ttgacagaat
     2341 ccaaagcgcc gccgtgcaga ccaacaatga gctggctggt gccctgcacc atttgaggtg
     2401 cgccagaatc agatactacg tcaagtgtgt ccaggaggcc ctgtattcca tcattcaaat
     2461 tgctggggct gcatttgtca ctacgcgcat taccaagcgc atgaacatac aagacctatg
     2521 gtccaagcca caagtggaaa acacagagga gaccaccagc aaggacgggt gcccaaaacc
     2581 taaggacgat gaggagtttg tcatttcatc cgacgacatc aaaactgagg gcaagaaagg
     2641 gaagaacaaa actggccgcg gcaagaagca cacagcattt tcaagcaaag gcctcagtga
     2701 tgaagagtac gatgagtaca agaggattag agaagaaagg aatggcaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgactga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttta ggccaacaag
     2881 gaaacaacgc aaggaggaaa gagcctctct cggtctggtc acaggcactg agatcaggaa
     2941 aagaaaccca gatgacttca aacccaaggg gaaattgtgg gctgacgatg acaggagtgt
     3001 ggactacaat gagaaactca gttttgaggc cccaccaagc atctggtcga gaatagtcaa
     3061 ctttggttca ggctggggat tctgggtctc ccccagtctg ttcataacat caacccatgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaatac aggtacacaa
     3181 gtcaggcgag ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggcgcac ctgagggcac cgtggtcaca ctactcatca aaaggtccac
     3301 tggggaactc atgcccctag cagctaggat ggggacccat gcgaccatga agatccaagg
     3361 gcgcactgtt ggaggtcaga tgggcatgct tctgacagga tccaacgcca agagcatgga
     3421 cctgggtact acaccaggtg attgtggctg cccctatatc tacaagagag gcaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc acgtggggga aacactgtca tatgtgccac
     3541 ccaggggagt gaaggagagg ctacacttga aggtggtgac aacaagggga catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aacacttagc accaagacca aattctggag
     3661 atcgtccaca gcatcactcc cacctggcac ctatgaacca gcctatcttg gtggcaagga
     3721 ccctagagtc aagggtggcc cttcactgca gcaagtcatg agggaacagt tgaagccatt
     3781 cacagagcca aggggcaagc caccaaaacc aagtgtatta gaagctgcca agaagaccat
     3841 catcaatgtc cttgagcaaa caattgatcc acctgagaaa tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacaa cttccagtgg tcatccgcac cacatgcgga agaacgactg
     3961 ctggaacggg gagtccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgaccccagt ctacacagct gcgctcaagg atgagttagt
     4081 taaaactgac aaaatttatg gtaagatcaa gaagaggctc ctctggggct cggacctggc
     4141 gaccatgatc cggtgtgctc gggcattcgg aggcctaatg gatgaactta aagcacactg
     4201 tgtcacactt cccattagag ttggcatgaa catgaatgag gatggtccca tcatcttcga
     4261 gaggcattcc aggtacacat atcactatga tgctgattac tctcgatggg attcaacaca
     4321 acagagagcc gtgttggcag cagctctgga aatcatggtt aaattctccc cagaaccaca
     4381 tttggctcag gtagtcgcgg aagaccttct ttctcccagc gtggtggacg tgggcgactt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgccc tgtacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc gctctctgaa gtcacaaacc tatcccctga
     4561 caccatacag gctaactccc tcttctcttt ttatggtgat gatgaaattg ttagcacaga
     4621 cataaaattg gacccagaga aattgacagc aaagctcaga gaatatgggt taaaaccaac
     4681 ccgccctgac aaaactgaag gaccccttgt catctctgaa gacctgaatg gcctaacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg tcccaaccat ggagacccat ctgaaacaat
     4861 gattccacac tcccaaagac ccatacaatt gatgtcccta ctgggggagg ccgctctcca
     4921 cggcccagca ttttacagta aaatcagcaa attggtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca gacaggagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgta gttggtgccg ccattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaacaatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatttga
     5341 atccctacct ttcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccgggaaaat catatttgca gcagtcccac
     5461 caaatttccc aactgaaggt ttgagcccca gccaagtcac tatgttcccc cacataatag
     5521 tagatgttag gcaattggaa cctgtgttga tccccttacc cgatgttagg aataatttct
     5581 accattataa tcaatcaaat gactccacca tcaaattgat agcaatgttg tacacaccac
     5641 ttagggctaa taatgccggg gacgatgtct tcacagtttc ttgtcgagtt ctcacgagac
     5701 catcccccga ttttgatttt atatttttgg tgccacccac agttgaatca agaactaaac
     5761 cattctctgt cccagtttta actgttgagg agatgaccaa ctcaaggttc cccattcctt
     5821 tggaaaaatt gttcacgggc cccagtagtg cctttgtcgt tcaaccacaa aacggcaggt
     5881 gcacgactga tggcgtgctc ctaggtacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccat atttcaggca gtagtaacta cacaatgaat ttggcctccc
     6001 aaaattggaa cagttacgat ccaacagaag aaattccagc ccctctagga actccagatt
     6061 tcgtggggaa gattcaaggt gtactcaccc aaaccacaag gacagatggc tcgacccgcg
     6121 gccacaaagc tacagtgtac actgggagcg ccgacttctc tccaaaactg ggtagagttc
     6181 aatttgccac tgacacagac aatgattttg aaactaacca aaacacaaag ttcaccccag
     6241 tcggtgttat ccaggatggt gctactaccc accgaaatga accccaacaa tgggtgctcc
     6301 caagttactc aggcagaaac actcataatg tgcacctggc ccccgctgta gcccccactt
     6361 tcccgggcga gcagcttctc ttcttcagat ctactatgcc cggatgcagc gggtacccca
     6421 acatggactt ggactgtctg ctcccccagg aatgggtgca gtacttctac caggaggcag
     6481 ccccagcaca atctgatgtg gctctgttaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg taagcttcat aagtcaggct atgttacagt ggctcacact ggccaacatg
     6601 atttggttat cccccccaat ggttatttta gatttgattc ctgggtcaac cagttctata
     6661 cacttgcccc catgggaaat gggacggggc gtagacgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg acgtccttgg ctctggactt ggttccctaa tcaatgctgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaataac agaaaattgc aacaagcttc
     6841 cttccaattt agtagcaatc tacaacaggc ttcctttcaa catgacaaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagttgca acaggaaatg atgagagtta aacaagcaat
     6961 gctcctagag ggtggatttt ctgagacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaaact ttggactgga gcgggacgag gtactgggct cccgatgcta ggactacaac
     7081 atataatgca ggccgctttt ccacccctca accctcgggg gcgccaccag ggagagctaa
     7141 tcttagggct actgtccccg cccggggttc ctctagtacg tcttctaact cttctattgc
     7201 tacttctgtg tattcaaatc aaaccacctc aacgagactt ggttctacag ctggttctgg
     7261 taccagtgtc tcgagcctcc cgtcaactgc aaggactagg agctgggttg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccacaacatc tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc gaccgtgccc aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgca agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gatcatcttt ccttttct
//