Typing tool

Complete norovirus genomes

KC517376  GII.4 Sydney
 GII.P31

Length: 7,509 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       KC517376                7509 bp    RNA     linear   VRL 02-APR-2015
DEFINITION  Norovirus Hu/GII-4/Taoyuan/CGMH66/2012/TW ORF1, VP1, and VP2 genes,
            complete cds.
ACCESSION   KC517376
VERSION     KC517376.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII-4/Taoyuan/CGMH66/2012/TW
  ORGANISM  Norovirus Hu/GII-4/Taoyuan/CGMH66/2012/TW
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7509)
  AUTHORS   Chen,S.Y., Feng,Y., Chao,H.C., Lai,M.W., Huang,W.L., Lin,C.Y.,
            Tsai,C.N., Chen,C.L. and Chiu,C.H.
  TITLE     Emergence in Taiwan of Novel Norovirus GII.4 Variants Causing Acute
            Gastroenteritis and Intestinal Hemorrhage in Children
  JOURNAL   J. Med. Microbiol. (2015) In press
   PUBMED   25752853
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Tsai,C.N., Lin,C.Y., Huang,W.L., Chen,Z.S., Chen,S.Y. and Chiu,C.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JAN-2013) Chang Gung University, Graduate Institute
            of Clinical Medical Sciences, No. 259, Wenhua 1st Rd., Guishan
            Township, Taoyuan County 333, Taiwan (R.O.C.)
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Vector NTI v. 10
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII-4/Taoyuan/CGMH66/2012/TW"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII-4/Taoyuan/CGMH66/2012/TW"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:1325218"
                     /country="Taiwan"
                     /collection_date="18-Aug-2012"
                     /note="genotype: GII.4"
     CDS             1..5100
                     /codon_start=1
                     /product="ORF1"
                     /protein_id="AGK25923.1"
                     /translation="MKMASNDASAAAVANSNNDIAKSSSDGVFSNMAVTFKRALGARP
                     KQPPPKEIPPRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILAACDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAVENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     VKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALGLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIIATNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNEILAFRQLAAENKYGLMDTMRVGKQLKDVKTM
                     SDLKQALKNITIKKCQIVYSGSTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIRIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEEMANKDGC
                     LKPKDDEEFVVSSDDIKTEGKKGKNKSGRGKKHAAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPNVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYGKVKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRDVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFQISISEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPFETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5081..6703
                     /note="viral capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AGK25924.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLSTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAV"
     CDS             6703..7509
                     /note="minor capsid protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AGK25925.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKRLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRANLRDAVPARGSSSKSS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSFPPTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 atgaagatgg cctctaacga cgcttccgct gccgctgttg ccaacagcaa caacgacatc
       61 gcaaaatctt caagtgacgg tgtgttttct aacatggctg tcacttttaa gcgggccctc
      121 ggggcgcggc ctaaacagcc gcccccgaag gaaataccac ccagaccccc gcgaccaccc
      181 acaccagaac tggtcaaaaa gatccctcct cccccaccca acggggagga tgaactagtg
      241 gtctcttaca gcgccaaaga tggcgtttcc ggactgcctg agctcaccac tgtcagacaa
      301 ccggaagaaa ccaacacggc gttcagtgtc cccccactca accaaaggga gagcagggac
      361 gccaaggagc cactaactgg aacaatcatt gaaatgtggg atggagaaat ctaccattac
      421 ggcctgtacg tggaacgagg tcttatactt ggtgtgcaca agccaccggc agccattagc
      481 cttgccaagg tcgagctagc accgctctct ttgttctgga gacctgtata caccccccag
      541 tatctcatct ctccagacac tcttaggaga ctacatggag agtcattccc ctacactgca
      601 tttgacaaca attgctacgc cttttgttgt tgggtattag acctaaacga ctcatggcta
      661 agcaggagaa tgattcagag aacaacaggt ttcttcaggc cgtaccagga ttggaacagg
      721 aaacccctcc ccactatgga tgattccaaa ttaaagaagg tagccaacat attcttgtgc
      781 actttgtctt cactattcac cagacccatt aaagacataa tagggaagtt gaaacctctt
      841 aacatcctta acattctggc tgcatgtgat tggaccttcg caggcatagt ggaatcctta
      901 atactcttgg cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatc
      961 gcccccttgc taggtgatta tgaactgcaa ggacctgagg accttgcagt ggaactggtc
     1021 ccaatagtga tgggggggat aggtttggtg ctaggattta ccaaagagaa aatcggaaag
     1081 atgctatcat ccgctgcatc cactttaaga gcttgtaaag accttggtgc atacggactg
     1141 gaaatcttaa aattggtcat gaagtggttc ttcccaaaga aagaggaagc aaatgaactg
     1201 gctatggtga ggtccatcga ggatgcagta ctagacctcg aggcagttga aaacaaccac
     1261 atgaccaccc tactcaaaga caaagacagc ttggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagccagaaa actctcaacc aaatctgctt cacccgatat tgtgggcaca
     1381 atcaactctc ttctggcaag aatcgccgct gcacgctccc tagtgcatcg ggcgaaagaa
     1441 gagctctcca gcaggccgag acctgtcgtt gtgatgatat cgggaagacc agggataggg
     1501 aaaactcacc ttgccaggga gctggtcaag aagatcgcgg cctccctcac aggggaccag
     1561 cgcgtgggtc ttatcccacg caatggtgtc gaccactggg acgcatacaa gggcgaaaga
     1621 gttgtcctat gggacgacta tggaatgagc aaccccatcc atgatgccct cgggttgcag
     1681 gagcttgctg acacttgccc cctcacgcta aattgtgaca gaattgagaa caaagggaaa
     1741 gtctttgaca gtgatgccat aattatcgcc accaatctgg ccaacccagc accactggat
     1801 tatgtcaact ttgaagcgtg ctcgagacgc attgacttcc tcgtgtacgc agaagcccct
     1861 gaggtggaga aggcaaagcg cgacttccca ggtcaacctg acatgtggaa gaacgctttc
     1921 agtcctgact tctcacacat aaaactgtca ttggctccac agggtggttt tgacaagaac
     1981 ggcaacaccc cgcatggaaa aggggtcatg aagaccctca ccactggctc cctcatcgcc
     2041 cgagcatcag ggctactcca tgagaggcta gatgaatatg aactgcaagg cccagccctc
     2101 accactttca actttgaccg caacgagata cttgctttta gacagcttgc tgctgaaaac
     2161 aagtatgggc tgatggacac aatgagagtt ggaaagcagc tcaaggatgt caagaccatg
     2221 tcagacctca aacaagcact caagaacatc acgatcaaga agtgccagat agtgtacagt
     2281 ggtagcacct acacacttga ggctgatggc aagggtagtg tgaaggttga caaagtgcaa
     2341 agtgccactg tgcagaccaa caatgaacta gccggtgccc tacaccacct aagatgcgct
     2401 agaatcagat actatgttaa gtgcgtccag gaggcactgt attccatcat ccgaatcgct
     2461 ggggctgcat tcgtcaccac gcgcatcgct aagcgtatga atatacagaa tctctggtcc
     2521 aagccacagg tggaagacac agaagagatg gccaacaagg atggttgcct aaaacccaaa
     2581 gatgatgaag agtttgtcgt ctcatccgac gacatcaaaa ctgagggcaa gaaagggaag
     2641 aacaagtccg gccgtggcaa gaagcacgca gccttttcaa gcaaagggct cagtgatgag
     2701 gagtacgatg agtacaagag aatcagagaa gaaaggaatg gtaagtactc catagaagag
     2761 taccttcagg acagagacaa gtactacgag gaggtggcca ttgccagggc aaccgaagag
     2821 gacttctgtg aagaagaaga ggccaaaatc cggcagagaa ttttcagacc aacaaggaaa
     2881 caacgcaaag aagagagggc ctctctcggc ttggtcacag gctctgaaat caggaagaga
     2941 aacccagaag acttcaaacc caagggaaag ctgtgggctg atgatgacag aagtgttgac
     3001 tacaatgaga aactcaactt tgaggcccca ccaagcatct ggtcgcggat agtcaacttt
     3061 ggttcaggct ggggcttctg ggtctccccc agtctgttta taacatcaac ccatgtcata
     3121 ccccaaggtg caaaagagtt cttcggagtc cctatcaagc aaatccagat acacaaatca
     3181 ggtgaattct gccggttgag attcccaaag ccaatcagaa ctgatgtgac gggcatgatt
     3241 ctagaagaag gtgcgcccga gggaaccgtg gccacactgc tcatcaagag accaactgga
     3301 gagctcatgc ctctggcagc cagaatgggg acccatgcaa ccatgaaaat tcaggggcgc
     3361 acagttggag ggcaaatggg tatgctcctg acaggatcca acgccaagag tatggaccta
     3421 ggcacaacac caggcgactg cggctgcccc tacatctaca agagggggaa tgactacgtg
     3481 gtcataggag tccatacggc cgctgcccgt ggaggaaaca ctgtcatatg tgccacccag
     3541 gggagtgagg gagaagccac acttgaagga ggtgacagta aagggacata ctgtggcgca
     3601 ccaatcttgg gcccagggag cgctccgaag ctcagtacca agactaagtt ttggagatca
     3661 tccacaacac cactcccacc tggcacctac gaaccggcct acctcggtgg caaagaccct
     3721 agagtcaaag gtggcccttc attgcaacaa gttatgaggg accagctgaa gccattcaca
     3781 gaacccagag gcaaaccacc aagaccaaat gtgttggaag ctgccaagaa aaccatcatc
     3841 aatgtccttg agcaaacaat tgatccaccc caaaaatggt catttgcgca agcttgcgca
     3901 tcccttgaca aaaccacctc cagcggccac ccgcaccaca tgcggaaaaa cgattgttgg
     3961 aatggggagt ccttcacagg gaaattggct gatcaagcct ccaaggccaa cctaatgttt
     4021 gaagagggaa agaacatgac tccagtctac acaggtgcac ttaaagatga gttggtaaag
     4081 accgataaag tttatggtaa ggtcaagaag aggcttctgt ggggttcaga tctggcgacc
     4141 atgatacggt gcgcccgagc ttttggaggc cttatggatg aactcaaggc acactgtgtc
     4201 acacttcctg tcagagttgg tatgaacatg aatgaggatg gccccatcat ctttgagaag
     4261 cactccagat atagatatca ctatgatgct gattattccc ggtgggactc gacacaacaa
     4321 agggatgtgc tagcagcagc actagaaatc atggttaagt tctctccaga accacacctg
     4381 gcccagatag ttgcagaaga cctcctttcc cctagcgtaa tggatgtagg tgactttcaa
     4441 atatcaataa gtgagggtct cccctctggg gtaccttgta cctcccagtg gaattccatc
     4501 gcccactggc tcctcactct gtgtgcactc tctgaagtca cggacctgtc ccctgacatc
     4561 attcaggcca actccctttt ctccttctat ggtgatgatg agattgtaag cacagacata
     4621 aagttggacc cagagaagct gacagcaaaa ctcaaggagt acgggctgaa accaacccgc
     4681 cccgacaaaa ctgaaggacc ccttgttatc tctgaagacc tggatggcct gacattcctc
     4741 cggagaactg tgacccgtga tccagctggc tggtttggaa agttggaaca aagttcaatt
     4801 ctcaggcaaa tgtactggac caggggtccc aaccatgaag atccatttga aacaatgata
     4861 ccacactccc aaagacccat acaattgatg tccttgctgg gcgaggctgc actccacggc
     4921 ccggcattct acagcaaaat tagcaaatta gtcattgcag agttgaagga gggtggcatg
     4981 gatttttacg tgcccagaca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtcgagtga
     5101 cgccaaccca tctgatgggt ccgcagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctctggag cccgttgttg gtgccgccat tgcggcacct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct ggtggagagt ttacagtatc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttgggccctg atctaaatcc
     5341 ctacctatcc catttggcca gaatgtacaa tggttatgca ggtggttttg aagtgcaggt
     5401 aattctcgcg gggaacgcgt tcaccgccgg gaaggtcata tttgcagcag tcccaccaaa
     5461 ttttccaact gaaggcttga gccccagcca agtcactatg ttcccccata tagtagtaga
     5521 tgttaggcaa ctagaacctg tgttgattcc cttacccgat gttaggaata atttctatca
     5581 ttacaatcaa tcaaatgacc ccaccattaa gttgatagca atgttgtata caccacttag
     5641 ggctaataat gctggggatg atgtcttcac agtttcttgc cgagttctca cgagaccatc
     5701 ccccgatttt gatttcatat ttctagtgcc acccacagtt gagtcaagaa ctaaaccatt
     5761 ctctgtccca gttttaactg ttgaggagat gaccaattca agattcccca ttcctttgga
     5821 aaagttgtcc acgggtccca gcagtgcctt tgttgtccaa ccacaaaacg gcaggtgcac
     5881 gactgatggc gtgctcctag gcaccaccca actgtctcct gtcaacatct gcaccttcag
     5941 aggagatgtc acccatatca caggtagtcg taactacaca atgaatttgg cttctcaaaa
     6001 ttggaacaat tatgacccaa cagaagaaat cccagcccct ctaggaactc cagattttgt
     6061 ggggaagatt cagggcgtgc tcacccaaac cacaaggaca gatggctcaa cacgcggcca
     6121 caaagctaca gtgtacactg ggagcgccga ctttgctcca aaactgggta gagttcaatt
     6181 tgaaactgac acagaccatg attttgaagc taaccaaaac acaaagttca ccccagttgg
     6241 tgtcatccaa gatggtggca ccacccaccg aaatgaaccc caacagtggg tgctcccaag
     6301 ttactcaggc agaaatactc ataatgtgca tctggccccc gctgtagccc ccacttttcc
     6361 gggtgagcaa cttctcttct tcagatccac catgcccgga tgcagcgggt accccaacat
     6421 ggatttggac tgtctgctcc cccaggaatg ggtgcagtac ttctaccaag aggcagcccc
     6481 agcacaatct gatgtggctc tgctaagatt tgtgaatcca gacacaggta gggttttgtt
     6541 tgagtgtaag cttcataaat caggctatgt tacagtggct cacactggcc aacatgattt
     6601 ggttatcccc cccaatggtt attttaggtt tgattcctgg gtcaaccagt tttacacgct
     6661 tgcccccatg ggaaatggaa cggggcgtag acgtgcagta taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttggctct ggacttggtt cccttatcaa tgctggggct
     6781 ggggccatca accaaaaagt tgagtttgaa aataacagaa aattgcaaca agcatccttc
     6841 caatttagta gcaatctaca acaggcttcc tttcaacatg acaaagagat gctccaagca
     6901 caaattgagg ccaccaaaag gctacaacag gaaatgatga aagttaagca ggcaatgctc
     6961 ctagagggtg ggttctctga gacagatgca gcccgcgggg caatcaacgc ccccatgaca
     7021 aaagctttgg actggagcgg gacaaggtac tgggctcccg atgctaggac tacgacatac
     7081 aatgcaggcc gcttttccac ccctcaacca tcgggggcac tgccaggaag agctaatctt
     7141 agggatgctg tccctgctcg gggttcctcc agcaagtctt ctaattcttc tactgctact
     7201 tctgtgtact caaatcaaac tacttcaacg agacttggtt ctacagctgg ttctggtacc
     7261 agtgtctcga gcttcccgcc aactgcaagg actaggagct gggttgagga tcaaagtagg
     7321 aatttgtcgc ctttcatgag gggggcccac aacatatcgt ttgtcacccc accatctagt
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag aggttttgga ctcctggact
     7441 ggcgctttca acacgcgcag gcagccactc ttcgctcaca ttcgtaagcg aggggagtca
     7501 cgggcgtaa
//