Typing tool

Complete norovirus genomes

KC517369  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,509 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       KC517369                7509 bp    RNA     linear   VRL 02-APR-2015
DEFINITION  Norovirus Hu/GII-4/Taoyuan/CGMH59/2012/TW ORF1, VP1, and VP2 genes,
            complete cds.
ACCESSION   KC517369
VERSION     KC517369.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII-4/Taoyuan/CGMH59/2012/TW
  ORGANISM  Norovirus Hu/GII-4/Taoyuan/CGMH59/2012/TW
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7509)
  AUTHORS   Chen,S.Y., Feng,Y., Chao,H.C., Lai,M.W., Huang,W.L., Lin,C.Y.,
            Tsai,C.N., Chen,C.L. and Chiu,C.H.
  TITLE     Emergence in Taiwan of Novel Norovirus GII.4 Variants Causing Acute
            Gastroenteritis and Intestinal Hemorrhage in Children
  JOURNAL   J. Med. Microbiol. (2015) In press
   PUBMED   25752853
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Tsai,C.N., Lin,C.Y., Huang,W.L., Chen,Z.S., Chen,S.Y. and Chiu,C.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JAN-2013) Chang Gung University, Graduate Institute
            of Clinical Medical Sciences, No. 259, Wenhua 1st Rd., Guishan
            Township, Taoyuan County 333, Taiwan (R.O.C.)
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Vector NTI v. 10
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII-4/Taoyuan/CGMH59/2012/TW"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII-4/Taoyuan/CGMH59/2012/TW"
                     /isolation_source="feces"
                     /host="Homo sapiens"
                     /db_xref="taxon:1325213"
                     /country="Taiwan"
                     /collection_date="23-Apr-2012"
                     /note="genotype: GII.4"
     CDS             1..5100
                     /codon_start=1
                     /product="ORF1"
                     /protein_id="AGK25907.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELSTVRQPE
                     ETSTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLNRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMMRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSIQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEDATNKDGC
                     PKPKDIEEFVISSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGTEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVAGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDGKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYPRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLRPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5081..6703
                     /note="viral capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AGK25908.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFATVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFETDTENDFETHQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNVPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6703..7509
                     /note="minor capsid protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AGK25909.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDREMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAVN
                     APMTKVLDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRVNPRTPTPARGSPNTSS
                     NASTATSLYLNQTVSTRLGSTAGSGTNVSSLPSTARTRSWVEDQSRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaatctt caagtgacaa aatgttttct agcatggctg tcacttttaa acgagccctc
      121 ggggcgcggc ccaaacagcc ccccccgagg gaaataccac aaagaccccc acgaccacct
      181 accccagaac tggtcaaaaa gatccctcct cccccgccca acggagagga tgaattagtg
      241 gtttcttaca gtgccaaaga tggcgtttcc ggtttacctg agctctccac cgtcaggcaa
      301 ccggaagaaa ctagtacggc cttcagtgtc cctccactca atcagaggga gaatagggat
      361 gctaaggaac cactgactgg aacaattctg gaaatgtggg atggagagat ctaccattat
      421 ggcctgtatg ttgagcgagg tcttgtgctg ggtgtgcaca aaccaccagc tgctattagc
      481 ctcgccaagg tcgaactaac accactctcc ttgttctgga gacctgtgta cactcctcag
      541 tacctcatct ctccagacac tctcaagaaa ttacacggag aaacattccc ctacacagcc
      601 ttcgacaaca attgctatgc cttttgttgc tgggtcctgg atctaaacga ctcgtggctg
      661 aacaggagaa tgatccagag aacaactggc ttcttcagac cttaccaaga ttggaatagg
      721 aaacctctcc ccactatgga tgattccaaa ttaaagaagg tggctaatat attcctgtgc
      781 accctgtctt cgctattcac caggcccata aaagacataa tagggaagtt aagacccctc
      841 aacatcatca acatcctggc ttcatgtgat tggaccttcg caggcatagt ggagtccttg
      901 atactcttgg cagagctctt tggagtcttc tggacacccc cagatgtgtc tgcgatgatt
      961 gcccccttac tcggtgactt cgagttacaa ggacctgagg accttgtagt ggagctcgtc
     1021 cctgtagtaa tggggggaat tggtttggtg ctagggttca ccaaagagaa aattggaaaa
     1081 atgttgtcat ctgctgcatc taccttgaga gcttgtaaag atcttggtgc atatgggcta
     1141 gagatcctaa agttagtcat gaagtggttc ttcccgaaga aagaagaagc aaatgaactg
     1201 gctatgatga gatccatcga ggatgcagta ctggatcttg aagcaattga aaacaaccac
     1261 atgaccacct tgctcaaaga caaagacagc ctggcaacct atatgagaac ccttgacctc
     1321 gaggaagaaa aagccagaaa actctcaacc aaatctgctt cacctgacat cgtgggcaca
     1381 atcaacgccc ttctggcgag aatcgccgct gcacgctcct tggtgcaccg agcgaaggag
     1441 gagctctcca gcagaccaag acctgtagtc ttgatgatat caggcagacc aggaataggg
     1501 aagacccacc ttgctaggga agtggctaag agaatcgcag cctccctcac aggagaccag
     1561 cgtgtgggcc tcatcccacg caatggcgtc gaccactggg atgcgtataa gggggagagg
     1621 gtcgtcctat gggacgacta cggaatgagc aatcccatcc acgacgccct caggctgcaa
     1681 gaactcgctg acacctgccc cctcactcta aattgtgaca ggattgagaa taaagggaag
     1741 gtctttgaca gcgatgtcat tatcatcact actaacctgg ccaacccagc accactggac
     1801 tatgttaact ttgaggcgtg ctcgaggcgc attgatttcc tcgtgtatgc agaagccccc
     1861 gaggtcgaaa aggcgaagcg tgacttcccg ggtcaacctg acatgtggaa aaacgctttt
     1921 agttctgatt tctcacacat aaaactggca ttggctccac aaggtggctt tgataagaac
     1981 gggaacaccc cacacgggaa gggcgtcatg aagaccctca ccactggctc cctcatcgcc
     2041 cgggcatcag ggctactcca tgagagattg gatgagtttg aactacaggg cccagctctt
     2101 accaccttca actttgaccg caacaaagtg cttgccttca ggcagcttgc tgctgaaaac
     2161 aaatacgggt tgatggacac aatgaaagtt gggaggcagc tcaaggatgt caaaaccatg
     2221 ccagaactta aacaagcact caagaatatc tcaatcaaga agtgccagat tgtgtatagt
     2281 ggttgcacct acacacttga gtctgatggt aagggcaatg tgaaagttga cagagttcag
     2341 agtacttcta ttcagaccaa caatgagctg gctggcgccc tgcatcacct aaggtgcgcc
     2401 agaatcaggt actatgtcaa gtgtgttcag gaggccctgt attctatcat ccagattgct
     2461 ggggctgcgt ttgtcaccac gcgcatcatc aagcgtgtga acattcaaga cttatggtcc
     2521 aagccacaag tggaaaacac agaggatgcc accaacaagg acgggtgtcc aaaacccaaa
     2581 gatattgagg agttcgtcat ttcatctgac gacattaaaa ctgagggtaa gaaagggaag
     2641 aacaaatctg gccgtggcaa gaagcacacg gccttctcaa gtaaaggtct cagtgatgaa
     2701 gagtatgatg agtacaagag aattagagag gaaaggaatg gcaagtactc catagaagag
     2761 tacctacagg acagggacag atactatgag gaggtggcca ttgccagggc gaccgaggaa
     2821 gacttctgtg aagaggagga ggccaagatc cggcaaagga tcttcagacc aacaaggaag
     2881 caacgcaagg aagaaagggc ttctctcggt ttagtcacag gcactgaaat taggaaaagg
     2941 aacccagaag acttcaagcc taaggggaaa ctatgggctg acgatgacag aagtgtggac
     3001 tacaatgaaa aactcagctt tgaggcccca ccaagcattt ggtcaaggat agtcaacttt
     3061 ggctcaggtt ggggcttctg ggtctccccc agcctgttca taacatcaac ccacgtcata
     3121 ccccagggcg caaaggagtt ctttggagtc cccatcaaac aaattcaggt gcacaagtca
     3181 ggcgaattct gtcgcttgag gttcccaaaa ccaatcagga ctgatgtggc tggcatgatc
     3241 ttggaagaag gtgcgcccga aggcaccgtg gttacactac tcatcaaaag gtctactgga
     3301 gaactcatgc ccctagcagc tagaatgggg acccatgcaa ccatgaagat tcaggggcgc
     3361 actgttggag gtcagatggg catgcttctg acaggatcca acgccaaaag catggatcta
     3421 ggcaccacac caggtgactg cggctgcccc tacatctaca agagagggaa tgactatgtt
     3481 gtcattgggg tccacacggc tgccgctcgt gggggaaaca ctgtcatttg tgccacccaa
     3541 gggggtgagg gggaagctac acttgaaggt ggtgacggta agggaacata ctgtggtgca
     3601 ccaatcctag gcccagggag tgccccaaaa cttagcacca aaaccaaatt ctggagatca
     3661 tccacagcac cactcccacc tggcacctat gaaccagcct acctaggtgg caaggatccc
     3721 agggtcaagg gtggcccctc gttgcagcaa gtcatgaggg accagctgaa accatttaca
     3781 gagcccaggg gtaagccacc aaagccaagt gtgttagaag ctgccaagaa aaccatcatc
     3841 aatgtccttg aacaaacaat tgacccacct gagaagtggt cgttcgcaca agcttgcgcg
     3901 tcccttgaca agaccacttc tagcggccat ccgcaccaca tgcggaaaaa cgactgctgg
     3961 aacggggaat ccttcacggg caagctggca gaccaggctt ccaaagccaa cctgatgttt
     4021 gaagagggga agaacatgac cccagtctac acaggtgcac ttaaggatga gttagtcaaa
     4081 actgacaaaa tttatggtaa gatcaagaag aggcttctct ggggctcgga tttagcaacc
     4141 atgatccggt gcgctcgagc attcggaggc ctaatggatg aactcaaagc acactgtgtc
     4201 acacttccta tcagagttgg tatgaacatg aatgaggatg gtcccatcat cttcgagaag
     4261 cattccaggt acagatacca ctatgatgct gattaccctc ggtgggattc aacacagcag
     4321 agagccgtgt tggcagctgc tctagaaatc atggttaaat tctcctcaga accacatttg
     4381 gctcaggtgg tagcagaaga cctcctttct cctagcgtgg tggatgtggg tgacttcaca
     4441 atatcaatca acgagggtct tccctctggg gtgccctgca cctcccaatg gaactccatc
     4501 gcccactggc ttctcactct ctgtgcactc tccgaagtca caaatttgtc cccagacatc
     4561 atacaggcta attctctctt ctccttctat ggtgatgatg aaattgttag tacagacata
     4621 aaattagacc cagagaaatt gacagcaaag cttaaggaat acggattgag accaactcgc
     4681 cctgataaaa ctgaaggacc tcttgttatc tctgaagact tagatggttt gaccttcctg
     4741 cggagaaccg tgacccgcga cccagctggt tggtttggaa aactggagca gagctcaata
     4801 ctcaggcaaa tgtactggac taggggcccc aaccatgaag atccatctga atcaatgatt
     4861 ccacactctc aaagacccat acaattgatg tccttactgg gagaggccgc actccacggc
     4921 ccaacattct acagcaaaat cagcaaatta gtcattgcag agctaaaaga aggtggtatg
     4981 gatttttacg tgcccaggca agagccaatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtcgaatga
     5101 cgccaaccca tctgatgggt ccgcagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgtcg gtgccgctat tgcggcgcct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa ataattttgt acaagcccct ggtggagagt tcacagtatc
     5281 ccctagaaac gctccaggtg aaatactatg gagcgcgccc ttaggccctg atctgaatcc
     5341 ctacctatct catttggcca gaatgtataa tggttatgca ggtggttttg aagtgcaggt
     5401 gattctcgcg gggaacgcgt tcaccgccgg aaaaattata tttgcaacag tcccaccaaa
     5461 ttttccaact gaaggcttga gtcccagtca ggtcaccatg ttcccccata taatagtgga
     5521 tgttaggcaa ttggaacctg tgttgatccc cttacctgat gttaggaata atttctacca
     5581 ctataatcag tcaaatgatt ctaccattaa attgatagca atgctgtata caccacttag
     5641 ggctaataat gctggggaag atgtcttcac agtctcttgt cgagttctca cgaggccatc
     5701 ccctgacttt gatttcatat ttttggtgcc acctacagtt gagtcaagaa ctaagccatt
     5761 tactgtccca atcctaactg ttgaagaaat gaccaactca aggttcccca ttcctttgga
     5821 gaagttgttc acgggtccca gcagtgcctt tgttgttcaa ccacaaaatg gcagatgcac
     5881 aactgatggc gtgctcttag gcaccaccca gctgtctcct gttaacatct gcaccttcag
     5941 aggggatgtc acccacattg caggttctcg taattacaca atgaatttgg cttctctaaa
     6001 ttggaacaac tatgacccaa cagaagaaat tccagcccct ctaggaactc cagatttcgt
     6061 gggaaagatc caaggtgtgc tcactcaaac cacaaaggga gatggctcga cccgtggcca
     6121 taaagctaca gtttacactg ggagtgcccc cttcactcca aagctgggca gtgtccaatt
     6181 cgaaactgac acagaaaatg attttgaaac ccaccaaaac acaaaattca ccccagtcgg
     6241 tgtcatccag gatggtggca ccacccaccg aaatgaacct caacaatggg tgctcccaag
     6301 ttattcaggt agaaatgtcc ctaatgtaca cctagcccct gctgtagccc ccacttttcc
     6361 gggtgaacaa ctccttttct ttaggtccac tatgcccgga tgcagcgggt atcccaacat
     6421 ggacttggac tgcctgctac cccaggagtg ggtgcagcac ttctaccaag aggcagctcc
     6481 agcacaatct gatgtggcgc tattgagatt tgtgaatcca gacacgggta gggtcctgtt
     6541 tgagtgcaaa cttcataaat caggctatgt cacagtggcc cacaccggtc agcatgattt
     6601 ggtcatcccc cccaatggtt attttaggtt tgattcctgg gttaaccaat tctacacgct
     6661 tgcccccatg ggaaacggaa cggggcgtag acgtgctttg taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttagctct ggacttggtt ccctaatcaa tgctggggct
     6781 ggggctatca accaaaagat tgattttgaa aataatagaa aattgcagca agcttccttc
     6841 cagtttagca gtaatctaca acaggcttcc tttcaacatg acagagagat gcttcaagca
     6901 caaattgagg ccactaaaaa gttgcaacag gaaatgatga aagtcaaaca ggcaatgctc
     6961 ttagaaggtg gattctctga aacagatgca gcccgtgggg cagtcaacgc ccctatgaca
     7021 aaggttttgg actggagcgg aacgaggtac tgggcccctg atgctaggac tacaacatac
     7081 aatgcaggcc gtttttccac ccctcaacct tcaggggcat tgccaggaag agtcaatccc
     7141 aggactccca cccccgctcg gggctccccc aacacatctt ctaatgcttc tactgctact
     7201 tctttgtatt taaatcaaac tgtttcaacg agacttggtt cgacagctgg ttctggcacc
     7261 aatgtctcga gtctcccgtc aactgcaagg actaggagtt gggttgagga tcaaagcaga
     7321 aatttgtcac ctttcatgag gggggctcac aacatatcgt tcgtcacccc accatctagt
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag aagttttgga ctcctggact
     7441 ggcgctttca acacgcgcag gcagcctctc ttcgctcaca ttcgtaggcg gggggagtca
     7501 cgggtgtaa
//