Typing tool

Complete norovirus genomes

KC464499  GII.12
 GII.P33

Length: 7,514 | 3 CDS

ORF1: 1..5106
ORF2: 5087..6694
ORF3: 6694..7485
LOCUS       KC464499                7514 bp    RNA     linear   VRL 19-DEC-2013
DEFINITION  Norovirus Hu/GII.12/CGMH41/2010/TW, complete genome.
ACCESSION   KC464499
VERSION     KC464499.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.12/CGMH41/2010/TW
  ORGANISM  Norovirus Hu/GII.12/CGMH41/2010/TW
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7514)
  AUTHORS   Tsai,C.N., Lin,C.Y., Lin,C.W., Shih,K.C., Chiu,C.H. and Chen,S.Y.
  TITLE     Clinical relevance and genotypes of circulating noroviruses in
            northern Taiwan, 2006-2011
  JOURNAL   J. Med. Virol. 86 (2), 335-346 (2014)
   PUBMED   24009100
REFERENCE   2  (bases 1 to 7514)
  AUTHORS   Tsai,C.N., Lin,C.Y., Lin,C.W., Shih,K.C., Huang,W.L., Chao,H.C.,
            Chen,S.Y. and Chiu,C.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JAN-2013) Chang Gung University, Graduate Institute
            of Clinical Medical Sciences, No. 259, Wenhua 1st Rd., Guishan
            Township, Taoyuan County 333, Taiwan (R.O.C.)
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Vector NTi v. 10
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7514
                     /organism="Norovirus Hu/GII.12/CGMH41/2010/TW"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.12/CGMH41/2010/TW"
                     /isolation_source="fecal"
                     /host="Homo sapiens"
                     /db_xref="taxon:1380576"
                     /country="Taiwan"
                     /collection_date="14-Jan-2010"
                     /note="genotype: GII.12"
     CDS             1..5106
                     /codon_start=1
                     /product="ORF1"
                     /protein_id="AGT39199.1"
                     /translation="MKMASNDASAAAAAISNNDIAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPRETTQKQKPPRPPTPELIKKIPPPPPNGEDDIVVSYSAKEGVSGLPELSTVRQ
                     PDETNTAFSVPPLNQRENRDAKEPLPGTILEMWDGEIYHYGLYVERGLVLGVHKPPAA
                     ISLAKVELTPLSLYWRPVYTPQYLISPETLKKLHGETFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDII
                     GKLRPLNILNILASCDWTFAGVVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKDEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDLEEEKARKL
                     STKSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLAR
                     DLAKKVAATLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELAD
                     TCPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPDV
                     EKAKRDFPGQPDMWKDAFRPDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTSGSLVA
                     RASGLLHERLDEYELQGPTPTTFNFDQNKVFAFRQLAAENKYGLMDTMRVGSQLKNVK
                     TVSELKQALKNIAIRRCQIVYSGLTYSLESDGKGNVRVEKVQSPAVQTNNELTGALHH
                     LRCARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSRPQVEDEEETTSKD
                     GCPKPKDEEEFVISSEDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREER
                     NGKYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLG
                     LITGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWV
                     SPSLFVTSTHVIPQGAQEFFGVSIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAP
                     EGTVATLLIKRPTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTP
                     GDCGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEAVLEGGDNKGTYCGAPI
                     LGPGNAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFT
                     EPRGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTFAQACASLDKTTSSGYPHHVRKNE
                     HWNGESFTGKLADQASKANLMFEEGKHMTPVYTGALKDELVKTDKIYGKIKKRLLWGS
                     DLATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYTYHYDADYSR
                     WDSTQQRAVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISITEGLPSGVP
                     CTSQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAK
                     LKEYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTR
                     GPNHEDPAETMIPHSQRPIQLMSLLGEAALHGPSFYSKISKLVISELKEGGMDFYVPR
                     QEPMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5087..6694
                     /note="viral capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AGT39200.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRLNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAVPPHFPLENISPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQNEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPILTIGELTNSRFPVPIDELYTSPNESLVVQPQNGRCALDGELQGTT
                     QLLPTAICSFRGRINQKVSGENHVWNMQITNINGTPFGPTEDVPAPLGTPDFSGKLFG
                     VLSQRDHDNACRSHDAVIATNSAKFTPKLGAIQIGTWEQDDVHINQPTKFTPVGLFES
                     EGFNQWTLPNYSGALTLNMGLAPPVAPTFPGEQILFYRSHIPLKGGVADPVIDCLLPQ
                     EWIQHLYQESAPSQTDVALIRFTNPDTGRVLFEAKLHRSGYITVANTGSRPIVVPANG
                     YFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     CDS             6694..7485
                     /note="minor capsid protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AGT39201.1"
                     /translation="MAGAFIAGLAGDIVTNGIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQIQATKQLQADMIAIRQGVLTAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRHWAPGAMKTTAFSGGFTSASHARTVDLTRKTSATPASMPVSRPSSTASTVSTRSTL
                     ISGSSNPSSLARSSSSISSQSTSSSSRTSDWVRSQNRALEPYMSGALRTAYVTPPSSR
                     ASSNGTVSTVPKEVLDSWTSASTHSINTHRQPLFAHLRRRGESQV"
ORIGIN      
        1 atgaagatgg cctctaacga cgcttccgct gccgctgctg ctatcagcaa caacgacatc
       61 gcaaaatctt caagtgacgg agtactaagt agtatggctg tcacttttaa acgagccctc
      121 ggggcccggc ctaaacagcc gcccccgagg gaaacaacac aaaaacaaaa acctccacga
      181 ccgcccaccc cggagttaat caaaaagatt ccacctcccc cgcccaacgg ggaggacgat
      241 atagtggtat cctacagtgc caaagagggg gtctccggcc tgcctgagct atccaccgtc
      301 aggcagccgg atgagacaaa cacagcattt agtgtccccc cactcaacca gagggaaaac
      361 agggatgcta aagaaccgct gcctggcacc atattggaaa tgtgggacgg agagatctac
      421 cactacggct tgtacgtgga gcggggtttg gtgcttgggg tgcacaaacc accagcggct
      481 attagcctcg caaaggttga actaacacca ctgtctctgt actggagacc agtgtacacc
      541 cctcagtacc tcatatcccc ggaaacactc aaaaagctac atggagagac attcccttac
      601 acggcctttg ataacaactg ttacgccttc tgttgttggg tcttggatct aaacgactct
      661 tggctcagca ggaggatgat tcagagaaca actggcttct tcagacccta ccaggactgg
      721 aacaggaaac ctctccccac tatggatgat tccaaattga aaaaggtggc taatatagtc
      781 ctgtgtgctt tgtcatcact attcaccagg cccattaagg acataatagg aaaactaagg
      841 cccttaaaca tactcaacat actagcttcc tgcgactgga ctttcgcagg agtagtggaa
      901 tccctaattc tccttgcaga actcttcgga gttttctgga cacccccaga tgtgtctgcg
      961 atgatcgccc ccttactagg tgactacgaa ctacagggac ctgaagacct cgctgtagaa
     1021 ctcgtaccag tagtaatggg ggggataggt ttggttctag gtttcaccaa ggagaagatt
     1081 ggcaagatgc tgtcatccgc cgcgtccacc cttagagctt gtaaagacct tggagcatat
     1141 gggttagaaa tcctgaagtt ggtcatgaaa tggttcttcc cgaagaaaga cgaggcaaat
     1201 gaacttgcaa tggtgagatc cattgaggac gcagtgctgg acctcgaagc aattgaaaac
     1261 aatcacatga ccaccctgct caaagacaaa gacagtttgg caacctacat gaagactctg
     1321 gatcttgaag aggagaaagc taggaaactc tccaccaaat ccgcttctcc tgatattgtg
     1381 ggcacaatca attcacttct ggcacggatt gcagctgccc gttccctggt gcaccgggca
     1441 aaagaagagc tttccagtag gccaagaccc gttgttgtta tgatatcagg aaagccagga
     1501 atagggaaga cccatcttgc cagagatttg gcaaagaaag ttgcagccac cctcacagga
     1561 gaccagaggg tgggcctcat cccacggaat ggtgtcgacc attgggatgc atacaaaggt
     1621 gagagagtcg tcctttggga tgactatgga atgagtaacc ccattcatga cgcccttagg
     1681 ctacaagaac tcgctgacac ttgcccccta acattaaatt gtgatagaat tgagaacaaa
     1741 ggaaaggttt ttgacagtga tgccataatt attacaacta atttggctaa cccggcacca
     1801 ctggactatg ttaactttga agcatgttcg aggcgtatcg acttccttgt gtacgctgat
     1861 gcccccgacg ttgaaaaggc aaaacgcgac ttcccagggc aacctgacat gtggaaggat
     1921 gcttttagac ctgacttctc acacataaaa ttaatgttgg ctcctcaggg tggttttgat
     1981 aagaacggca acaccccaca tggaaaaggc gtcatgaaaa ccctcacatc tggctccctc
     2041 gttgcccgtg cttcaggact cctccacgaa agactggacg agtacgagtt gcaagggcca
     2101 acacccacaa ccttcaattt cgaccaaaac aaggtgttcg cctttaggca gctcgccgct
     2161 gaaaataaat acgggctgat ggacaccatg agagtgggaa gccagctcaa gaatgtcaaa
     2221 actgtgtcag agctcaaaca ggcactcaag aacattgcaa ttagaaggtg ccagatagtc
     2281 tacagtggtc tcacatactc acttgaatct gatggcaaag gtaatgtaag ggttgagaag
     2341 gtgcaaagtc cagctgtgca gaccaacaat gagctaactg gcgcactaca ccatctgagg
     2401 tgcgctagga ttagatatta tgttaagtgt gttcaggaag ctttgtattc catcatccaa
     2461 attgctgggg ccgcgtttgt caccacgcgc attgcaaagc gcatgaacat acaaaacctc
     2521 tggtccagac cacaggtgga ggatgaggaa gagaccacca gcaaagacgg atgcccaaaa
     2581 ccaaaggatg aggaggagtt tgtcatctcg tctgaagaca tcaaagtcga aggcaagaag
     2641 ggaaagaaca agtctggccg tggcaagaaa cacacagcct tttcgagtaa aggtcttagt
     2701 gatgaggagt acgatgagta taaaagaatt agagaagaaa gaaatggtaa gtactccata
     2761 gaagaatacc tccaggacag agacaagtac tatgaggagg tggccatagc cagggctact
     2821 gaagaggact tctgtgagga agaagaagcc aagattcgtc agaggatttt cagaccaaca
     2881 aggaaacaac gcaaggagga gagggcttca ctcggactga ttacaggctc agaaatcagg
     2941 aaaaggaacc cggatgactt caaacccaaa ggaaaactgt gggctgatga tgacaggagt
     3001 gtcgattaca atgaaaagct cagttttgag gcccccccaa gcatctggtc gagaatagtc
     3061 aactttggat caggttgggg cttctgggtc tcaccaagcc tttttgtaac atccacccat
     3121 gtcatacctc aaggggcaca agaatttttc ggtgtttcca tcaaacagat ccaaattcac
     3181 aagtcgggtg aattctgccg actaagattc ccaaaaccaa ttagaactga tgtgacaggt
     3241 atgatcctgg aggagggggc ccctgaaggg actgtggcca cactgctcat aaagaggcca
     3301 actggagagc tgatgccact ggcagctaga atgggtaccc atgcaactat gaggatccag
     3361 ggtcgaactg tcggggggca gatggggatg ctcctgacgg gatccaacgc caagagcatg
     3421 gatttgggta ccacaccagg tgactgtgga tgcccatata tatacaaaag aggaaatgac
     3481 tacgtagtca tcggggtcca cacagctgcc gcccgcggag ggaacactgt catctgtgca
     3541 acacaaggaa gtgagggcga ggctgtgctt gaaggtggcg acaacaaagg cacctattgt
     3601 ggcgccccaa tcctaggtcc aggaaatgcc cccaaactca gtactaaaac caaattctgg
     3661 aggtcctcaa cagcaccact cccacctggc acatatgaac cagcttacct cggaggcaaa
     3721 gaccccagag taaaaggtgg cccctcatta cagcaagtta tgagagacca actgaaacca
     3781 tttacagaac ccagaggtaa gccaccaaag cccagtgtac tagaagcagc caaaaagaca
     3841 atcattaatg tccttgagca aacaatagac ccaccccaaa aatggacgtt cgcacaggcg
     3901 tgcgcatccc tcgacaaaac aacctctagt ggctacccgc accacgtgcg gaagaatgaa
     3961 cattggaatg gggaatcttt cacaggaaaa ttggctgatc aggcttcaaa agctaacctg
     4021 atgtttgagg aaggtaaaca catgacacca gtctacacag gagccctcaa ggatgagtta
     4081 gtcaaaactg ataaaatata tggcaagatc aagaagaggt tgctatgggg ttcagacctg
     4141 gcaaccatga tccgctgcgc tcgagcgttc ggagggttaa tggatgaact caaggctcac
     4201 tgtgtcacac tccccatcag ggtagggatg aacatgaatg aggatggccc catcattttt
     4261 gagaaacact ctagatacac ctaccattat gatgcagact actctcggtg ggactcaaca
     4321 cagcagagag ctgttttagc tgcagccctg gagatcatgg taaaattttc cccagaacca
     4381 cacctggccc agatcgttgc agaggatctc ctatctccca gcgtgatgga cgtgggcgat
     4441 ttcaaaatat caatcactga aggactcccc tctggggtgc cttgcacctc acaatggaat
     4501 tctattgctc attggctcct cacgctttgt gcactctctg aggtaacaga tttgtctcct
     4561 gacatcatcc aagcaaactc actcttctct ttctatggtg acgatgaaat tgtgagcaca
     4621 gacatcaaat tagatccaga aaagctgaca gctaaactaa aagagtatgg tctcaagcca
     4681 acccgtcctg acaagactga agggcctctg gtcatttctg aggacttaga tggtctgacc
     4741 ttcttacgga ggactgtgac ccgtgaccca gcaggttggt ttggaaaatt ggaacaaagc
     4801 tcaatactta gacagatgta ttggaccagg ggccccaacc atgaggatcc cgctgaaaca
     4861 atgataccac actcccaaag acccatacag ttgatgtccc tattaggtga agctgcatta
     4921 catggcccat cattctacag caaaatcagc aaattggtca tctcagagtt aaaagagggt
     4981 ggcatggact tttacgtgcc aaggcaagag ccaatgtttc gatggatgag gttctcagac
     5041 ttgagcacgt gggagggcga tcgcaatctg gctcccagtt ttgtgaatga agatggcgtc
     5101 gaatgacgcc gctccatcta atgatggtgc agccggtctc gtaccagagg tcaacaatga
     5161 gaccatggca cttgaaccgg tggctggggc ttcaatagcc gccccactca ccggtcaaaa
     5221 taatgttata gacccctgga ttagattaaa ctttgtgcaa gctcccaatg gagagtttac
     5281 agtttcaccc cgcaattcgc ctggggaagt cctactaaac ttggaattag gccctgaact
     5341 aaatccatat ttggcacacc tttccagaat gtacaatggt tatgcaggtg gagttgaggt
     5401 gcaagtacta ctggctggga acgcgttcac ggctggaaaa ctggtattcg ccgcagttcc
     5461 ccctcatttt ccattagaaa acataagccc tggccaaata accatgttcc ctcatgtaat
     5521 tattgatgtt aggactttag aaccagtcct attgcctctt ccagatgtta ggaacaattt
     5581 cttccactac aatcagcaaa acgaaccgag gatgaggctt gtggcaatgc tctatacccc
     5641 ccttaggtct aatggttctg gtgatgatgt atttactgtc tcctgtagag tgcttactcg
     5701 accctctcct gattttgatt tcaattattt ggtaccccct acagttgaat ctaaaactaa
     5761 acccttcaca ctccccatct taaccatagg ggagttaacc aattccagat tccctgtgcc
     5821 tatagatgaa ctctacacta gccccaatga gagtttggtg gtacaacccc agaacgggag
     5881 atgcgcgctg gatggggagt tgcagggtac tactcagctc ctccccacgg cgatctgctc
     5941 gttcaggggt cggattaatc agaaagtgag tggagagaac catgtttgga atatgcaaat
     6001 caccaacatt aacggaaccc cttttggtcc aacagaggat gttccagctc ctctaggtac
     6061 accagacttt tctggcaagc tctttggcgt cctaagccag agggaccatg ataatgcctg
     6121 taggagccat gatgcagtga ttgcaactaa ttctgctaaa tttaccccaa aattgggcgc
     6181 tatacaaatt ggcacatggg aacaagatga tgtacacatc aaccaaccca ccaaatttac
     6241 tccagttggc ttgtttgaaa gtgaaggttt taatcagtgg acactcccta attattctgg
     6301 agccttaaca ctcaacatgg ggttggcccc ccctgtggcc cccacatttc ctggcgagca
     6361 aattcttttc tacagatccc acattcctct taaaggaggt gtggcagacc cagttattga
     6421 ttgtctcttg ccccaagagt ggatccaaca cctttatcag gagtcagccc cttcacaaac
     6481 agatgtagca ctgatcagat tcacaaatcc agacacaggg cgtgtcctat ttgaagcaaa
     6541 attgcacagg agtggctaca tcacagtggc caacactggt agcagaccaa ttgtggtgcc
     6601 agctaatggt tacttcagat ttgactcttg ggttaatcag ttttattctc tcgcccccat
     6661 gggaactggg aatgggcgca gaagggtgca gtaatggctg gagctttcat agcaggtctt
     6721 gctggtgata tagtcaccaa tggtattggc tcactcgtga acgctggggc caatgcaata
     6781 aaccaaaaag tagactttga aaacaataag caactacagc aggcatcctt caatcatgac
     6841 aaagagatgc tgcaagctca aattcaagcc accaaacagc tacaggctga tatgattgca
     6901 atcagacaag gggtgttgac cgcgggcggc ttctccccca ctgatgcagc aagaggtgca
     6961 gtcaacgcac ccatgacaca ggtcttggac tggaacggga ctagacattg ggcccccgga
     7021 gccatgaaaa caactgcttt ctccggtggg ttcaccagtg cttctcatgc caggaccgtt
     7081 gacctgacta ggaaaacatc agccacacca gcctctatgc ctgtctctag gcccagttct
     7141 actgcctcta ctgtttccac ccgttctacc ttgattagtg gatcctctaa tccttcttct
     7201 ctagctagga gttcttccag tatttcttcc caatctactt cctcatcctc tcggactagt
     7261 gattgggtac gtagccaaaa cagagcactg gagccttata tgagcggggc gctgcgtaca
     7321 gcctacgtga cacctccatc cagtagggct tctagcaatg gcacagtctc aaccgtgcca
     7381 aaagaggttt tggactcctg gacatctgca tcaacacact ctatcaacac acacagacaa
     7441 ccgctgtttg ctcatctccg tcggagaggg gagtcacaag tttagtgaaa agatggtctt
     7501 ttctttcatt cctt
//