Typing tool

Complete norovirus genomes

KC464498  GII.12
 GII.P33

Length: 7,522 | 3 CDS

ORF1: 1..5109
ORF2: 5090..6697
ORF3: 6697..7476
LOCUS       KC464498                7522 bp    RNA     linear   VRL 19-DEC-2013
DEFINITION  Norovirus Hu/GII.12/CGMH40/2010/TW, complete genome.
ACCESSION   KC464498
VERSION     KC464498.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.12/CGMH40/2010/TW
  ORGANISM  Norovirus Hu/GII.12/CGMH40/2010/TW
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7522)
  AUTHORS   Tsai,C.N., Lin,C.Y., Lin,C.W., Shih,K.C., Chiu,C.H. and Chen,S.Y.
  TITLE     Clinical relevance and genotypes of circulating noroviruses in
            northern Taiwan, 2006-2011
  JOURNAL   J. Med. Virol. 86 (2), 335-346 (2014)
   PUBMED   24009100
REFERENCE   2  (bases 1 to 7522)
  AUTHORS   Tsai,C.N., Lin,C.Y., Lin,C.W., Shih,K.C., Huang,W.L., Chao,H.C.,
            Chen,S.Y. and Chiu,C.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JAN-2013) Chang Gung University, Graduate Institute
            of Clinical Medical Sciences, No. 259, Wenhua 1st Rd., Guishan
            Township, Taoyuan County 333, Taiwan (R.O.C.)
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Vector NTi v. 10
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7522
                     /organism="Norovirus Hu/GII.12/CGMH40/2010/TW"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.12/CGMH40/2010/TW"
                     /isolation_source="fecal"
                     /host="Homo sapiens"
                     /db_xref="taxon:1380575"
                     /country="Taiwan"
                     /collection_date="12-Jan-2010"
                     /note="genotype: GII.12"
     CDS             1..5109
                     /codon_start=1
                     /product="ORF1"
                     /protein_id="AGT39196.1"
                     /translation="MKMAASNDASAAAAAISNNDIAKSSSDGVLSSMAVTFKRALGAR
                     PKQPPPRETTQKQKPPRPPTPELIKKIPPPPPNGEDDIVVSYSAKEGVSGLPELSTVR
                     QPDETNTAFSVPPLNQRENRDAKEPLPGTILEMWDGEIYHYGLYVERGLVLGVHKPPA
                     AISLAKVELTPLSLYWRPVYTPQYLISPETLKKLHGETFPYTAFDNNCYAFCCWVLDL
                     NDSWLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDI
                     IGKLRPLNILNILASCDWTFAGVVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQG
                     PEDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKW
                     FFPKKDEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDLEEEKARK
                     LSTKSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLA
                     RDLAKKVAATLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELA
                     DTCPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPD
                     VEKAKRDFPGQPDMWKDAFRPDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTSGSLV
                     ARASGLLHERLDEYELQGPTPTTFNFDQNKVFAFRQLAAENKYGLMDTMRVGSQLKNV
                     KTVSELKQALKNIAIRRCQIVYSGLTYSLESDGKGDVRVEKVQSPAVQTNNELTGALH
                     HLRCARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSRPQVEDEEETTSK
                     DGCPKSKDEEEFVISSEDIKAEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREE
                     RNGKYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASL
                     GLVTGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFW
                     VSPSLFVTSTHVIPQGAQEFFGVSIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGA
                     PEGTVATLLIKRPTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTT
                     PGDCGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEAVLEGGDNKGTYCGAP
                     ILGPGNAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPF
                     TEPRGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTFAQACASLDKTTSSGYPHHVRKN
                     EHWNGESFTGKLADQASKANLMFEEGKHMTPVYTGALKDELVKTDKIYGKIKKRLLWG
                     SDLATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYTYHYDADYS
                     RWDSTQQRAVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISITEGLPSGV
                     PCTSQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTA
                     KLKEYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWT
                     RGPNHEDPAETMIPHSQRPIQLMSLLGEAALHGPSFYSKISKLVISELKEGGMDFYVP
                     RQEPMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     CDS             5090..6697
                     /note="viral capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AGT39197.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRLNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAVPPHFPLENISPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQNEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPILTIGELTNSRFPVPIDELYTSPNESLVVQPQNGRCALDGELQGTT
                     QLLPTAICSFRGRINQKVSGENHVWNMQVTNINGTPFDPTEDVPAPLGTPDFSGKLFG
                     VLSQRDHDNACRSHDAVIATNSAKFTPKLGAIQIGTWEENDVHINQPTKFTPVGLFES
                     EGFNQWTLPNYSGALTLNMGLAPPVAPTFPGEQILFFRSHIPLKGGVADPVIDCLLPQ
                     EWIQHLYQESAPSQTDVALIRFTNPDTGRVLFEAKLHRSGYITVANTGSRPIVVPANG
                     YFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     CDS             6697..7476
                     /note="minor capsid protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AGT39198.1"
                     /translation="MAGAFIAGLAGDIVTNGIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQIQATKQLQADMIAIRQGVLTAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRHWAPGAMKTTAFSGGFTSASHARTVDLTRKTSATPASMPVSRPSSTASTVSTRSTL
                     ISGSSSPSSLARSSSSISSQSTSSSSRTSDWVRSQNRALEPYMSGALRTAYVTPPSSR
                     ASSNGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRRRGESQV"
ORIGIN      
        1 atgaagatgg ccgcgtctaa cgacgcttcc gctgccgctg ctgctatcag caacaacgac
       61 atcgcaaaat cttcaagtga cggagtacta agtagtatgg ctgtcacttt taaacgagcc
      121 ctcggggccc ggcctaaaca gccgcccccg agggaaacaa cacaaaaaca aaaacctcca
      181 cgaccgccca ccccggaatt aatcaaaaag attccacctc ccccgcccaa cggggaggac
      241 gatatagtgg tatcctacag tgccaaagag ggggtctccg gcctgcctga gctatccacc
      301 gtcaggcagc cggatgagac aaacacagca tttagtgtcc ccccactcaa ccagagggaa
      361 aacagggatg ctaaagaacc gctgcctggc accatattgg aaatgtggga cggagagatc
      421 taccactacg gcttgtacgt ggagcggggt ttggtgcttg gggtgcacaa accaccagcg
      481 gctattagcc tcgcaaaggt tgaattaaca ccactgtctc tgtactggag accagtgtac
      541 acccctcagt acctcatatc cccggaaaca ctcaaaaagc tacatggaga gacattccct
      601 tacacggcct ttgataacaa ctgttacgcc ttctgttgtt gggtcttgga tctaaacgac
      661 tcttggctca gcaggaggat gattcagaga acaactggct tcttcagacc ctaccaggac
      721 tggaacagga aacctctccc cactatggat gattccaaat tgaaaaaggt ggctaatata
      781 gtcctgtgtg ctttgtcatc actattcacc aggcccatta aggacataat aggaaaacta
      841 aggcccttaa acatactcaa catactagct tcctgcgact ggactttcgc aggagtggtg
      901 gaatccctaa ttctccttgc agaactcttc ggagttttct ggacgccccc agatgtgtct
      961 gcgatgatcg cccccttact aggtgactac gaactacagg gacctgaaga tctcgctgta
     1021 gaactcgtac cagtagtaat gggggggata ggtttggttc taggtttcac caaggagaag
     1081 attggcaaga tgctgtcatc cgccgcgtcc accctcagag cttgtaaaga ccttggagca
     1141 tatgggttag aaatcctgaa gttggtcatg aaatggttct tcccgaagaa agacgaggca
     1201 aatgaacttg caatggtgag atccattgag gacgcagtgc tggacctcga agcaattgaa
     1261 aacaatcaca tgaccaccct gctcaaagac aaagacagtt tggcaaccta catgaagact
     1321 ctggatcttg aagaggagaa agctaggaaa ctctccacca aatccgcttc ccctgatatt
     1381 gtgggcacaa tcaattcact tctggcacgg attgcagctg cccgttccct ggtgcaccgg
     1441 gcaaaagaag agctttccag taggccaaga cccgttgttg ttatgatatc aggaaagcca
     1501 ggaataggga agacccatct tgccagagat ttggcaaaga aagttgcagc caccctcaca
     1561 ggagaccaga gggtgggcct catcccacgg aatggtgtcg accattggga tgcatacaaa
     1621 ggtgagagag tcgtcctttg ggatgactat ggaatgagta accccattca tgacgccctt
     1681 aggctacaag aacttgctga cacttgcccc ctaacattaa attgtgatag aattgagaac
     1741 aaaggaaagg tttttgacag tgatgccata attattacaa ctaatttggc taacccggca
     1801 ccactggact atgttaactt tgaagcatgt tcgaggcgta tcgacttcct tgtgtacgct
     1861 gatgcccccg acgttgaaaa ggcaaaacgc gacttcccag ggcaacctga catgtggaag
     1921 gatgctttta gacctgactt ctcacacata aagttaatgt tggctcctca gggtggtttt
     1981 gataagaacg gcaacacccc acatggaaaa ggtgtcatga aaaccctcac atctggctcc
     2041 ctcgttgccc gtgcttcagg actcctccac gaaagactgg acgagtacga gttgcaaggg
     2101 ccaacaccca caaccttcaa tttcgaccaa aacaaggtgt tcgcctttag gcagctcgcc
     2161 gctgaaaata aatacgggct gatggacacc atgagagtgg gaagccagct caagaatgtc
     2221 aaaactgtgt cagagctcaa acaggcactc aagaacattg caattagaag gtgccagata
     2281 gtctacagtg gtctcacata ctcacttgaa tctgatggca aaggtgatgt aagggttgag
     2341 aaggtgcaaa gtccagctgt gcagaccaac aatgagctaa ctggcgcact acaccatctg
     2401 aggtgcgcta ggattagata ttatgttaag tgtgttcagg aagctttgta ttccatcatc
     2461 caaattgctg gggccgcgtt tgtcaccacg cgcattgcaa agcgcatgaa catacaaaac
     2521 ctctggtcca gaccacaggt ggaggatgag gaagagacca ccagcaaaga cgggtgccca
     2581 aaatcaaagg atgaggagga gtttgtcatc tcgtctgaag acatcaaagc cgaaggcaag
     2641 aagggaaaga acaagtctgg ccgtggcaag aaacacacag ccttttcgag taaaggtctt
     2701 agtgatgagg agtacgatga gtataaaaga attagagaag aaagaaatgg taagtactcc
     2761 atagaagaat acctccagga cagagacaag tactatgagg aggtggccat agccagggct
     2821 actgaagagg acttctgtga ggaagaagaa gccaagattc gtcagaggat tttcagacca
     2881 acaaggaaac aacgcaagga ggagagggct tcactcggac tggttacagg ctcagaaatc
     2941 aggaaaagga acccggatga cttcaagccc aaaggaaaac tgtgggctga tgatgacagg
     3001 agtgtcgatt acaatgaaaa gctcagtttt gaggcccccc caagcatctg gtcgagaata
     3061 gtcaactttg gatcaggttg gggcttctgg gtctcaccaa gcctttttgt aacatccacc
     3121 catgtcatac ctcaaggggc acaagaattt ttcggtgttt ccatcaaaca gatccaaatt
     3181 cacaagtcgg gtgaattctg ccgactaaga ttcccaaaac caattagaac tgatgtgaca
     3241 ggtatgatcc tggaggaggg ggcccctgaa gggactgtgg ccacactgct cataaagagg
     3301 ccaactggag agctgatgcc actggcagct agaatgggta cccatgcaac tatgaggatc
     3361 cagggtcgaa ctgtcggggg gcagatgggg atgctcctga cgggatccaa cgccaagagc
     3421 atggatttgg gtaccacacc aggtgactgt ggatgcccat acatatacaa aagaggaaat
     3481 gactacgtag tcatcggggt ccacacagct gccgcccgcg gagggaacac tgtcatctgt
     3541 gcaacacaag gaagtgaggg cgaggctgtg cttgaaggtg gcgacaacaa aggcacctat
     3601 tgtggcgccc caatcctagg tccaggaaat gcccccaaac tcagtactaa aaccaaattc
     3661 tggaggtcct caacagcacc actcccacct ggcacatatg aaccagctta cctcggaggc
     3721 aaagacccca gagtaaaagg tggcccctca ttacagcaag ttatgagaga ccaactgaaa
     3781 ccatttacag aacccagagg taagccacca aagcccagtg tactagaagc agccaaaaag
     3841 acaatcatta atgtccttga gcaaacaata gacccacccc aaaaatggac gttcgcacag
     3901 gcgtgcgcat ccctcgacaa aacaacctct agtggctacc cgcaccacgt gcggaagaat
     3961 gaacattgga atggggaatc tttcacagga aaattggctg atcaggcttc aaaagctaac
     4021 ctgatgtttg aggaaggtaa acacatgaca ccagtctaca caggagccct caaggatgag
     4081 ttagtcaaaa ctgataaaat atatggcaag atcaagaaga ggttgctatg gggttcagat
     4141 ctggcaacca tgatccgctg cgctcgagcg ttcggagggt taatggatga actcaaggct
     4201 cactgtgtca cactccccat cagggtaggg atgaacatga atgaggatgg ccccatcatt
     4261 tttgagaaac actctagata cacctaccat tatgatgcag actactctcg gtgggactca
     4321 acacagcaga gagctgtttt agctgcagcc ctggagatca tggtaaaatt ttccccagaa
     4381 ccacacctgg cccagatcgt tgcagaggat ctcctatctc ccagcgtgat ggacgtgggc
     4441 gatttcaaaa tatcaatcac tgaaggactc ccctctgggg tgccttgcac ctcacaatgg
     4501 aattctattg ctcattggct cctcacgctt tgtgcactct ctgaggtaac agatttgtct
     4561 cctgacatca tccaagcaaa ctcactcttc tctttctatg gtgacgatga aattgtgagc
     4621 acagacatca aattagatcc agaaaagctg acagctaaac taaaagagta tggtctcaag
     4681 ccaacccgtc ctgacaagac tgaagggcct ctggtcattt ctgaggactt agatggtctg
     4741 accttcttac ggaggactgt gacccgtgac ccagcaggtt ggtttggaaa attggaacaa
     4801 agctcaatac ttagacagat gtattggacc aggggcccca accatgagga tcccgctgaa
     4861 acaatgatac cacactccca aagacccata cagttgatgt ccctattagg tgaagctgca
     4921 ttacatggcc catcattcta cagcaaaatc agcaaattgg tcatctcaga gttaaaagaa
     4981 ggtggcatgg acttttacgt gccaaggcaa gagccaatgt ttcgatggat gaggttctca
     5041 gacttgagca cgtgggaggg cgatcgcaat ctggctccca attttgtgaa tgaagatggc
     5101 gtcgaatgac gccgctccat ctaatgatgg tgcagccggt ctcgtaccag aggtcaacaa
     5161 tgagaccatg gcacttgaac cggtggctgg ggcttcaata gccgccccac tcaccggtca
     5221 aaataatgtt atagacccct ggattagatt aaactttgtg caagctccca atggagagtt
     5281 tacagtttca ccccgcaatt cgcctgggga agtcctacta aacttggaat taggccctga
     5341 actaaatcca tatttggcac acctttccag aatgtacaat ggttatgcag gtggagttga
     5401 ggtgcaagta ctactggctg ggaacgcgtt cacggctgga aaactggtat tcgccgcagt
     5461 tccccctcat tttccattag aaaacataag ccctggccaa ataaccatgt tccctcatgt
     5521 aattattgat gttaggactt tagaaccagt cctattgcct cttccagatg ttaggaacaa
     5581 tttctttcac tacaatcagc aaaacgaacc gaggatgagg cttgtggcaa tgctctatac
     5641 cccccttagg tctaatggtt ctggtgatga tgtatttact gtctcctgca gagtgcttac
     5701 tcgaccctct cctgattttg atttcaatta tttggtaccc cctacagttg aatctaaaac
     5761 taaacccttc acactcccca tcttgaccat aggggagtta accaattcca gattccctgt
     5821 gcctatagat gaactctaca ctagccccaa tgagagtttg gtggtacaac ctcagaacgg
     5881 gagatgcgcg ctggatgggg agttgcaggg tactactcag ctcctcccca cggcgatctg
     5941 ctcgttcagg ggtcggatta atcagaaagt gagtggagag aaccatgttt ggaatatgca
     6001 agtcaccaac attaacggaa ccccttttga tccaacagag gatgttccag ctcctctagg
     6061 tacaccagac ttttctggca agctctttgg tgtcctaagc cagagggacc atgataatgc
     6121 ctgtaggagc catgatgcag tgattgcaac taattctgct aaatttaccc caaaattggg
     6181 cgctatacaa attggcacat gggaagaaaa tgatgtacac atcaaccaac ccaccaaatt
     6241 tactccagtt ggcttgtttg aaagtgaagg ttttaatcag tggacactcc ctaattattc
     6301 tggagcctta acactcaaca tggggttggc cccccctgtg gcccccacat ttcctggcga
     6361 gcaaattctt ttcttcagat cccacattcc tcttaaagga ggtgtggcag acccagttat
     6421 tgattgtctc ttgccccaag agtggatcca acacctttat caggagtcag ccccttcaca
     6481 aacagatgta gcactgatca gattcacaaa tccagacaca gggcgtgtcc tatttgaagc
     6541 aaaattgcac aggagtggct acatcacagt ggccaacact ggtagcagac caattgtggt
     6601 gccagctaat ggttacttca ggtttgactc ttgggttaat cagttttatt ctctcgcccc
     6661 catgggaact gggaatgggc gcagaagggt gcagtaatgg ctggagcttt catagcaggt
     6721 cttgctggtg acatagtcac caatggtatt ggctcactcg tgaacgctgg ggccaatgca
     6781 ataaaccaaa aagtagactt tgaaaacaat aagcaactac agcaggcatc cttcaatcat
     6841 gacaaagaga tgctgcaagc tcaaattcaa gccaccaaac agctacaggc tgatatgatt
     6901 gcaatcagac aaggggtgtt gaccgcgggc ggcttctccc ccactgatgc agcaagaggt
     6961 gcagtcaacg cacccatgac acaggtcttg gactggaacg ggactagaca ttgggccccc
     7021 ggagccatga aaacaactgc tttctccggt gggttcacca gtgcttctca tgccaggacc
     7081 gttgacctga ctaggaaaac atcagccaca ccagcctcta tgcctgtctc taggcccagt
     7141 tctactgcct ctactgtttc cacccgttct accttgatta gtggatcctc tagtccttct
     7201 tctctagcta ggagttcttc cagtatttct tcccaatcta cttcctcatc ctctcggact
     7261 agtgattggg tacgtagcca aaacagagca ctggagcctt atatgagcgg ggcgctgcgt
     7321 acagcctacg tgacacctcc atccagtagg gcttctagca atggcacagt ctcaaccgtg
     7381 ccaaaagagg ttttggactc ctggacatct gcattcaaca cacacagaca accgctgttt
     7441 gctcatctcc gtcggagagg ggagtcacaa gtttagtgaa aagatggtct tttctttcat
     7501 tcctttgaaa tctctgtctt tt
//