Typing tool

Complete norovirus genomes

KC463910  GII.4 New Orleans
 GII.P4 New Orleans

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       KC463910                7559 bp    RNA     linear   VRL 15-APR-2013
DEFINITION  Norovirus Hu/GII.4/Ohio/684/USA, complete genome.
ACCESSION   KC463910
VERSION     KC463910.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Ohio/684/USA
  ORGANISM  Norovirus Hu/GII.4/Ohio/684/USA
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7559)
  AUTHORS   Dai,X., Lou,F., Ma,Y., Hughes,J.H. and Li,J.
  TITLE     Sequence analysis of GII human norovirus
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Dai,X., Lou,F., Ma,Y., Hughes,J.H. and Li,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-JAN-2013) Department of Food Science and Technology,
            The Ohio State University, 2015 Fyffe Road, Columbus, OH 43210, USA
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus Hu/GII.4/Ohio/684/USA"
                     /mol_type="genomic RNA"
                     /strain="684"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1316726"
                     /country="USA"
                     /collection_date="2012"
                     /note="group: II; genotype: 4"
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AGI96382.1"
                     /translation="MKMASNDASAAAVADSNNDTAKSSSDGMLSSMAVTFKRALGARP
                     KQPPPREKPQRPPRPPTPELVKNIPPPPPNGEDEIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELAPLPLYWRPVYTPQYLISPDTLKRLSGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKIKKVANIFLCALSSLFTRPIKDIIGK
                     IRPLNILNILASCDWTFAGVVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEALEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIRLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPAITTFNFDRNKVLAFRQLAAENKYGLMDTMRVGKQLKDVKTM
                     PELKQALKNVSIKKCQIVYSGCTYILESDGKGNVKVDRVQSAAVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQDLWSKPQVENTEETTSKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERSSLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIANFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPTLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGRIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTPPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLRPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHGDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="ORF2"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AGI96383.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIPGSHNYTMNLASQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTSTNGSTRGHKATVYTGSADFSPKLGRVQFSTDTNNDFETNQNTKFTPVGVIQDG
                     STTPRNEPQQWVLPSYSGRNIHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="ORF3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AGI96384.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKTLDWSGTRYWAPDARITTYNAGRFPTPQLSGAPPGRANLRATVPARGSSSTSS
                     NSSIATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRSLSPFLRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctgaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggaatgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcctccccc gagggaaaaa ccacaaagac ccccacgacc
      181 acctactcca gaactggtta aaaatattcc ccctccccca cccaacggag aggatgaaat
      241 agtggtttct tatagtgtca aagatggtgt ttccggcttg cctgaccttt ccaccgtcag
      301 gcaaccagaa gaatctaaca cggccttcag cgtccctcca ctcaatcaga gggagaatag
      361 agatgctaag gaaccactta ctggaacaat tctggaaatg tgggacgggg aaatctacca
      421 ctatggcctg tatgtggagc gaggtcttgt actaggtgtg cacaaaccac cagctgccat
      481 cagtctcgct aaggttgagc tagcaccact ccccttgtac tggagacctg tgtacactcc
      541 tcagtacctc atctctccag acactctcaa gagattatcc ggagaaacgt tcccctacac
      601 agcctttgac aacaactgtt atgccttttg ttgctgggtc ctggacctaa atgactcgtg
      661 gctgagcagg agaatgatcc agaggacaac tggtttcttc aggccctacc aagactggaa
      721 taggaaaccc cttcccacta tggatgactc caaaataaag aaggtagcta acatattcct
      781 gtgtgctctg tcctcgctgt tcaccagacc cataaaagat ataataggga agataaggcc
      841 tcttaacatc ctcaacatct tggcctcatg tgattggact tttgcaggcg tagtggagtc
      901 cctgatactc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttacttggtg attacgagct acaaggacct gaggacctcg cagtggagct
     1021 cgtccccgtg gtgatggggg gaattggttt ggtgttagga ttcaccaaag agaagatcgg
     1081 gaaaatgttg tcatctgccg cgtccacctt gagagcctgt aaagaccttg gtgcatatgg
     1141 gctagagatc ctaaagttgg tcatgaagtg gttcttcccg aagaaggagg aggcaaacga
     1201 gctggctata gtgaggtcta tcgaggatgc agtcctggat ctcgaagcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagcctggca acctatatga gaacacttga
     1321 ccttgaggag gagaaagcca ggaagctctc aaccaagtct gcctcacccg acatcgtggg
     1381 cacaatcaac gccctcctgg cgagaatcgc tgccgcacgt tctctggtgc atcgagcgaa
     1441 ggaggagctt tccagcagac caagacctgt ggtgttgatg atatcaggca ggccaggaat
     1501 agggaagacc cacctcgcta gggaagtggc taagagaatc gcagcctccc ttacaggaga
     1561 ccagcgtgtg ggtctcatcc cacgcaatgg cgtcgaccat tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg attatggaat gagcaaccct attcacgatg ccctcaggct
     1681 gcaagaactc gctgacactt gccccctcac tctaaactgt gacaggattg aaaataaagg
     1741 aaaggtcttt gacagcgatg tcatcattat caccactaat ctggccaacc cagcaccact
     1801 ggactatgtc aactttgagg catgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccttgaagtc gaaaaggcga agcgtgactt cccaggccag cctgacatgt ggaagaacgc
     1921 tttcagttct gatttctcac acataagact agcactggcc ccacagggtg gtttcgacaa
     1981 gaacgggaac accccacacg gaaagggcgt catgaagact ctcaccactg gctcccttat
     2041 tgcccgggca tcagggctac tccatgagag gttagatgaa tttgaactac agggtccagc
     2101 tattaccacc ttcaatttcg atcgcaataa agtgcttgcc tttagacagc ttgctgctga
     2161 aaataaatat gggttgatgg acacaatgag ggttgggaaa caactcaagg atgtcaaaac
     2221 catgccagaa ctcaaacaag cactcaagaa tgtctcaatc aagaagtgcc aaatagtgta
     2281 tagtggttgc acctacatac ttgagtctga tggcaagggc aatgtgaaag ttgacagagt
     2341 ccaaagcgcc gccgtgcaga ccaacaatga gctggctggt gccctgcacc atctgaggtg
     2401 cgccagaatc agatactatg tcaagtgtgt ccaggaggcc ctatactcca tcattcaaat
     2461 tgctggggct gcatttgtca ccacgcgcat tgccaagcgc atgaacatac aagacctatg
     2521 gtccaagcca caagtggaaa atacagagga gaccaccagc aaggacgggt gcccaaaacc
     2581 taaggatgat gaggagtttg tcatttcatc tgacgacatc aaaactgagg gtaagaaagg
     2641 gaagaacaaa actggtcgcg gcaagaagca cacagcattt tcaagcaaag gcctcagtga
     2701 tgaagagtac gatgagtaca agaggattag agaagaaagg aatggcaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgactga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttta ggccgacaag
     2881 aaaacaacgc aaggaggaaa gatcctccct cggtctggtc acaggctctg aaattaggaa
     2941 aagaaaccca gatgacttca aacccaaggg gaaattgtgg gctgacgatg acaggagtgt
     3001 ggactacaat gagaaactca gttttgaggc cccaccaagc atctggtcga gaatagccaa
     3061 ctttggttca ggctggggat tctgggtctc ccccagtctg ttcataacat caacccatgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaatac aggtacacaa
     3181 gtcaggcgag ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatattagaa gaaggcgcac ctgagggcac cgtggtcaca ctactcatca aaaggtccac
     3301 tggggaactc atgcccctag ctgctaggat ggggacccat gcgaccatga agatccaagg
     3361 gcgcactgtt ggaggccaga tgggcatgct tctgacagga tccaacgcca agagcatgga
     3421 cctgggtact acaccaggtg attgtggctg cccctatatc tacaagaggg gtaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc gcgtggggga aacactgtca tatgtgccac
     3541 ccaggggagt gaaggagagg ccacacttga aggtggtgac aacaagggga catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aacactcagc accaagacca aattctggag
     3661 atcgtccaca gcaccactcc cacctggcac ctatgaacca gcctatctcg gtggcaagga
     3721 ccctagagtc aagggtggcc cttcactgca gcaagtcatg agggaacagt tgaagccatt
     3781 cacagagcca aggggcaagc caccaaaacc aagtgtatta gaagctgcca agaagaccat
     3841 tatcaatgtc cttgagcaaa caattgatcc acctgagaaa tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttccagtgg ccatccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgaccccagt ctacacagct gcgctcaagg atgagttagt
     4081 taaaactgac aaaatttatg gtaggatcaa gaagaggctt ctctggggct cggacttggc
     4141 gaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcacactg
     4201 tgtcacacct cccattagag ttggaatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaggcattcc aggtacacat atcactatga tgctgattac tctcggtggg attcaacaca
     4321 acagagagcc gtgttggcag cagctctgga aatcatggtc aaattctccc cagaaccaca
     4381 cttggctcag gtagtcgcgg aagaccttct ttctcctagc gtggtggatg tgggcgattt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgccc tgcacctctc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc gctctctgaa gtcacaaacc tatcccctga
     4561 taccatacag gctaactccc tcttctcttt ttatggtgat gatgaaattg ttagcacaga
     4621 cataaaattg gacccagaga aattgacagc aaagctcaag gagtatgggt taagaccaac
     4681 ccgccctgac aaaactgaag gaccccttgt catctctgaa gacctgaatg gcttaacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaattgg agcagagttc
     4801 aatactcagg caaatgtatt ggactagggg tcccaaccat ggagaccctt ctgaaacaat
     4861 gattccacac tcccaaagac ccatacaatt gatgtcccta ctgggggagg ccgctctcca
     4921 cggcccagca ttttacagta aaatcagcaa attggtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtg gttggtgccg ctattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaacaatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatttga
     5341 atccctacct ttcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatact cgcggggaac gcgttcaccg ccgggaaaat catatttgca gcagtcccac
     5461 caaatttccc aactgaaggt ttgagcccca gccaggtcac tatgttcccc cacataatag
     5521 tagatgtcag gcaattggaa cctgtgttga tccccttacc cgatgttagg aataatttct
     5581 accattataa tcaatcaaat gattccacca tcaaattgat agcaatgttg tacacgccac
     5641 ttagggctaa taatgccggg gatgatgtct tcacagtttc ttgtcgagtt cttacgagac
     5701 catcccccga ttttgatttt atatttttgg tgccacccac agttgaatca agaactaaac
     5761 cattttctgt cccaatttta actgttgagg agatgaccaa ttcaaggttc cccattcctt
     5821 tggaaaagtt gttcacaggc cccagtagtg cctttgttgt ccaaccacaa aacggcaggt
     5881 gcacgactga tggcgtgctc ctaggtacca ctcaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccat attccaggca gtcataacta cacaatgaat ttggcctccc
     6001 aaaattggaa cagttacgat ccaacagaag aaatcccagc ccctctagga actccagatt
     6061 tcgtggggaa gattcaaggt gtgctcactc aaaccactag tacaaatggc tcgacccgcg
     6121 gccacaaagc tacagtgtac actgggagcg ccgacttttc tccaaaactg ggtagagttc
     6181 aattttccac tgacacaaac aatgattttg aaactaacca aaatacaaaa ttcaccccag
     6241 tcggcgttat ccaggatggt agtactaccc cccgaaatga accccaacaa tgggtgctcc
     6301 caagttactc aggcagaaac attcacaatg tgcacctagc ccccgctgtg gcccccactt
     6361 tcccgggcga gcagctcctc ttcttcagat ctactatgcc cggatgcagc gggtacccca
     6421 acatggattt ggattgtctg ctcccccagg aatgggtgca gtacttctac caggaggcag
     6481 ccccagcaca atctgatgtg gctctgttaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg taagcttcat aaatcaggct atgttacagt ggctcatact ggccaacatg
     6601 atttggttat cccccccaat ggttatttta gatttgattc ctgggtcaac cagttctaca
     6661 cacttgcccc catgggaaat gggacggggc gtagacgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg acgtccttgg ctctggactt ggttccctaa tcaatgctgg
     6781 ggccggggcc atcaaccaaa aagttgaatt tgaaaataac aggaaattgc aacaagcttc
     6841 tttccagttt agcagcaatc tacaacaggc ttcctttcaa catgacaaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagttgca acaggaaatg atgagagtta aacaagcaat
     6961 gctcctagag ggtgggttct ctgagacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaaact ttggactgga gcgggacaag gtactgggct cccgatgcta ggattacaac
     7081 atataatgca ggccgctttc ccacccctca actctcgggg gcaccaccag gaagagcaaa
     7141 tctcagggct actgtccccg cccggggttc ctccagtacg tcttctaact cttctattgc
     7201 tacttctgtg tattcaaatc aaaccacctc aacgagactt ggttctacag ctggttctgg
     7261 taccagtgtc tcgagcctcc cgtcaactgc aaggactagg agctgggttg aggatcaaaa
     7321 taggagtttg tcacctttct tgaggggggc tcacaacatc tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgccc aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgca agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaaat tgattatctt tctcttcttt agtgtcttt
//