Typing tool

Complete norovirus genomes

KC175342  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,511 | 3 CDS

ORF1: 3..5102
ORF2: 5083..6705
ORF3: 6705..7511
LOCUS       KC175342                7511 bp ss-RNA     linear   VRL 13-MAR-2013
DEFINITION  Norovirus Hu/Norwalk/10034/2009/VNM, complete genome.
ACCESSION   KC175342
VERSION     KC175342.1
DBLINK      BioProject: PRJNA70471
KEYWORDS    .
SOURCE      Norovirus Hu/Norwalk/10034/2009/VNM
  ORGANISM  Norovirus Hu/Norwalk/10034/2009/VNM
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7511)
  AUTHORS   Madupu,R., Halpin,R.A., Ransier,A., Fedorova,N., Tsitrin,T.,
            McLellan,M., Stockwell,T., Amedeo,P., Appalla,L., Bishop,B.,
            Edworthy,P., Gupta,N., Hoover,J., Katzel,D., Li,K., Schobel,S.,
            Shrivastava,S., Thovarai,V., Wang,S., My,P.V., Campbell,J.,
            Farrar,J., Vinh,H., Hoang,N.V., Wentworth,D.E. and Baker,S.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-OCT-2012) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
COMMENT     Genome sequence lacks part of non-coding region.
            
            ##Assembly-Data-START##
            Assembly Method       :: clc_ref_assemble_long v. 3.22.55705
            Coverage              :: 356.8x
            Sequencing Technology :: Illumina; 454
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7511
                     /organism="Norovirus Hu/Norwalk/10034/2009/VNM"
                     /mol_type="genomic RNA"
                     /strain="Hu/Norwalk/10034/2009/VNM"
                     /host="Homo sapiens; sex: M"
                     /db_xref="taxon:1261195"
                     /country="Viet Nam: Ho Chi Minh City"
                     /collection_date="14-May-2009"
                     /PCR_primers="fwd_name: Ampl_1_Forward, fwd_seq:
                     gtgaatgawgatggcgt, rev_name: Ampl_1_Reverse, rev_seq:
                     ttggttgagagyttyctg"
                     /PCR_primers="fwd_name: Ampl_2_Forward, fwd_seq:
                     ccgcaaaatcttcaagtg, rev_name: Ampl_2_Reverse, rev_seq:
                     cwacaggtcttggtctgctrga"
                     /PCR_primers="fwd_name: Ampl_3_Forward, fwd_seq:
                     tcaaccaartctgcttcacctg, rev_name: Ampl_3_Reverse, rev_seq:
                     ratcctttgccggatcttgg"
                     /PCR_primers="fwd_name: Ampl_4_Forward, fwd_seq:
                     ggcaagaagcacacagcctt, rev_name: Ampl_4_Reverse, rev_seq:
                     crrctctytgttgtgttgaatccc"
                     /PCR_primers="fwd_name: Ampl_5_Forward, fwd_seq:
                     tctctggggytcggayttrg, rev_name: Ampl_5_Reverse, rev_seq:
                     acaacaaargcacygctrgg"
                     /PCR_primers="fwd_name: Ampl_6_Forward, fwd_seq:
                     ccatyaaaytgatagcaatgytg, rev_name: Ampl_6_Reverse,
                     rev_seq: atcaatyttgtcttttcaca"
                     /note="genotype: II"
     gene            3..5102
                     /gene="POL"
     CDS             3..5102
                     /gene="POL"
                     /note="genome polyprotein"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AFX81120.1"
                     /translation="MKMASNDASAAAVANGNNDTAKSSSDKMFSNMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEVVVSYSAKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTIDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLIDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRIQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATNKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRVVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTSLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     mat_peptide     3..992
                     /gene="POL"
                     /product="protein p48"
     mat_peptide     993..2090
                     /gene="POL"
                     /product="NTPase"
                     /note="p41"
     mat_peptide     2091..2627
                     /gene="POL"
                     /product="protein p22"
     mat_peptide     2628..3026
                     /gene="POL"
                     /product="viral genome-linked protein"
                     /note="VPg"
     mat_peptide     3027..3569
                     /gene="POL"
                     /product="3C-like protease"
                     /note="3CLpro; calicivirin"
     mat_peptide     3570..5099
                     /gene="POL"
                     /product="RNA-directed RNA polymerase"
     gene            5083..6705
                     /gene="VP1"
     CDS             5083..6705
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="AFX81121.1"
                     /translation="MKMASNDANPSDGSAANLVPEVSNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQTNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSGAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRDVHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     gene            6705..7511
                     /gene="VP2"
     CDS             6705..7511
                     /gene="VP2"
                     /note="minor capsid protein"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="AFX81122.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKVLDWSGTRYWAPDARTTTYNAGRFSTPQPSGTLPGRTNPRTPTPARGSSSTSS
                     NASTATSILSNQTASTRLGSTAGSGTNVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 gaatgaagat ggcgtctaac gacgcttccg ctgccgctgt tgctaacggc aacaacgaca
       61 ccgcaaaatc ttcaagtgac aaaatgtttt ctaacatggc tgtcactttt aaacgagccc
      121 tcggggcgcg gcctaaacag ccccccccga gggaaatacc acaaagaccc ccacgaccac
      181 ctactccaga actggtcaaa aagatccctc ctcccccgcc caacggagag gatgaagtag
      241 tggtttctta tagtgccaaa gatggcgttt ccggtttacc tgagctttcc accgtcaggc
      301 aaccggaaga aaccaatacg gccttcagtg tccctccact caaccagagg gagaatagag
      361 atgctaagga accactgact ggaacaattc tggaaatgtg ggatggagaa atctaccatt
      421 atggcctgta tgttgagcga ggtcttgtgc tgggtgtgca caaaccacca gctgccataa
      481 gcctcgccaa ggtcgaacta acaccactct ccttgttctg gagacctgtg tacactcccc
      541 agtacctcat ctctccagac actctcaaga aattacacgg agaaacgttt ccctacacag
      601 cctttgacaa caattgctat gccttttgtt gttgggtcct ggatctaaat gactcgtggc
      661 tgagtaggag aatgatccag agaacaactg gcttcttcag accctaccaa gactggaata
      721 ggaaacccct ccccactata gatgactcca aattaaagaa ggtagctaac attttcctgt
      781 gcgccctgtc ttcgctattc accaggccca taaaagacat aataggaaag ctaagacctc
      841 tcaacatcat caacatcctg gcttcatgtg attggacttt cgcaggcata gtggagtcct
      901 tgatactctt ggcagagctc tttggagtct tctggacacc cccagatgtg tctgcgatga
      961 ttgccccctt actcggtgat ttcgagttac aaggacctga ggaccttgta gtggagctcg
     1021 tccctgtagt aatgggggga attggtttgg tgctgggatt caccaaagag aagattggaa
     1081 aaatgttgtc atctgctgca tccaccttga gagcttgtaa agatcttggt gcatatgggc
     1141 tagagatcct aaagttagtc atgaagtggt tcttcccgaa gaaagaggag gcaaatgaac
     1201 tggctatggt gagatccatc gaggatgcag tactggacct tgaggcaatt gaaaacaacc
     1261 atatgaccac cttgctcaaa gacaaagaca gcctggcaac ctacatgaga acccttgacc
     1321 tcgaggaaga gaaagccaga aaactatcaa ccaagtctgc ttcacctgac atcgtgggca
     1381 caatcaacgc ccttctggcg agaatcgccg ctgcacgctc cctggtgcac cgagcgaagg
     1441 aggagctttc cagcagacca agacctgtag tcttgatgat atcaggcaga ccagggatag
     1501 gaaaaaccca ccttgctagg gaagtggcta agagaatcgc agcctccctc acaggagacc
     1561 agcgtgtagg cctcatccca cgcaatggcg tcgatcactg ggatgcgtac aagggggaga
     1621 gggtcgtcct atgggacgac tatggaatga gcaaccccat tcacgacgcc cttaggctgc
     1681 aagaactcgc cgacacttgc ccccttactc taaattgtga caggattgag aataaaggaa
     1741 aggtctttga cagcgatgtc atcattatca ccactaatct ggccaaccca gcaccactgg
     1801 actatgtcaa ctttgaagcg tgctcgaggc gcatcgattt cctcgtgtat gcagaagccc
     1861 ccgaggtcga aaaggcgaag cgtgacttcc cgggccaacc tgacatgtgg aaaaacgctt
     1921 ttagttctga tttctcacac ataaaattgg cactggctcc acaaggtggc tttgataaga
     1981 acgggaacac cccacacggg aagggcgtca tgaagactct caccactggc tccctcattg
     2041 cccgggcatc agggctgctc catgagagat tggatgagtt tgaactacag ggcccagctc
     2101 ttaccacctt caactttgac cgcaacaagg tgcttgcctt cagacagctt gctgctgaaa
     2161 acaaatatgg gttgatagac acaatgaaag ttgggaggca gctcaaggat gtcaaaacca
     2221 tgccagaact taaacaagca ctcaagaaca tctcaatcaa gaagtgccag attgtgtata
     2281 gtggttgcac ctacacactt gagtctgatg gcaagggcaa tgtgaaagtt gacagaatcc
     2341 agagcacctc cgtacagacc aacaatgagc tggctggcgc cctgcatcat ctgaggtgcg
     2401 ccagaatcag gtactatgtc aagtgtgtcc aggaggccct gtattctatc atccagattg
     2461 ctggggctgc atttgtcacc acgcgcatca tcaagcgtgt gaacattcaa gacttatggt
     2521 ccaagccaca agtggaaaac acagaggagg ctaccaacaa ggacgggtgt ccaaaaccca
     2581 aagatgatga ggagttcgtc atttcatctg acgacattaa aactgagggt aagaaaggga
     2641 agaacaagac tggccgtggc aagaagcata cagccttctc aagtaaaggt ctcagtgatg
     2701 aagagtatga tgagtacaag agaattagag aggaaaggaa tggcaagtat tccatagaag
     2761 agtaccttca ggacagggac aaatactatg aggaggtggc cattgccagg gcgaccgagg
     2821 aagacttctg tgaagaggag gaggccaaga tccggcaaag gatcttcaga ccaacaagga
     2881 aacaacgcaa ggaagaaaga gcttctctcg gtttagtcac aggttctgag attaggaaaa
     2941 gaaacccaga agacttcaag cctaagggaa aactatgggc tgacgatgac agaagtgtgg
     3001 actacaatga gaaactcagt tttgaggccc caccaagcat ctggtcaagg atagtcaact
     3061 ttggttcagg ttggggcttc tgggtctccc ctagcctgtt cataacatca acccacgtca
     3121 taccccaggg cgcaaaggag ttctttggag tccccatcaa acaaattcag gtacacaagt
     3181 caggcgaatt ctgtcgcttg aggttcccaa aaccaatcag gactgacgtg actggcatga
     3241 tcttggaaga aggtgcgccc gaaggcaccg tggtcacact actcatcaaa aggtctactg
     3301 gagaactcat gcccctagca gctagaatgg ggacccatgc aaccatgaaa attcaagggc
     3361 gcaccgttgg aggtcagatg ggcatgcttc tgacaggatc caacgccaaa agcatggatc
     3421 taggcaccac accaggtgat tgcggctgtc cctacatcta caagagagga aatgactatg
     3481 tggtcattgg agtccacacg gctgccgctc gtgggggaaa cactgtcata tgtgccaccc
     3541 aggggggcga gggggaagct acacttgaag gtggtgacag taagggaaca tactgtggtg
     3601 caccaatcct aggcccaggg agtgccccaa aacttagcac caaaaccaaa ttctggagat
     3661 catccacagc accactccca cctggcacct atgaaccagc ctaccttggt ggcaaggacc
     3721 ccagagtcaa gggtggccct tcgttgcagc aagtcatgag ggaccagctg aaaccattta
     3781 cagagcccag gggtaagcca ccaaagccaa gtgtgttaga agctgccaag aaaaccatca
     3841 tcaatgtcct tgaacaaacg attgacccac ctgagaagtg gtcgttcgcg caagcttgcg
     3901 cctcccttga caagaccact tctagcggcc atccgcacca tatgcggaaa aacgactgct
     3961 ggaatgggga gtccttcaca ggcaagctgg cagaccaggc ttccaaggct aacctgatgt
     4021 ttgaagaagg gaagaacatg accccagtct acacaggtgc acttaaggat gaattagtca
     4081 aaactgacaa aatttatggt aagatcaaga agaggcttct ctggggctcg gatttagcaa
     4141 ccatgatccg gtgtgctcga gcattcggag gcctaatgga tgaactcaaa gcacactgtg
     4201 tcacacttcc tattagagtt ggtatgaata tgaatgagga tggccccatc atcttcgaga
     4261 agcattccag gtacagatac cactatgatg ctgattactc tcggtgggat tcaacacaac
     4321 agagagtcgt gctggcagct gctctagaaa tcatggttaa attctcctca gaaccacatt
     4381 tggctcaggt agtcgcagaa gatcttcttt cccctagcgt ggtggatgtg ggtgacttca
     4441 caatatcaat caacgagggc cttccctctg gggtgccctg cacctcccaa tggaattcca
     4501 tcgcccactg gcttctcact ctttgtgcac tctccgaagt cacaagtttg tccccagaca
     4561 tcatacaggc taattcgctc ttctccttct atggtgatga tgaaattgtt agtacagaca
     4621 taaaattgga cccagagaag ttgacagcaa agctcaagga atatgggttg aaaccaaccc
     4681 gccccgacaa aactgaagga cctctcgtta tttctgaaga cttagatggt ttgactttcc
     4741 tgcggagaac tgtgacccgc gacccagctg gttggtttgg aaaactggag cagagctcaa
     4801 tactcaggca aatgtactgg actaggggcc ccaaccatga agatccatct gaatcaatga
     4861 ttccacactc tcaaagaccc atacaattga tgtccttact gggagaggcc gcactccacg
     4921 gcccaacatt ctacagtaaa atcagcaaac tagtcattgc agagctaaaa gaaggtggta
     4981 tggattttta cgtgcccagg caagagccaa tgttcagatg gatgagattc tcagatctga
     5041 gcacgtggga gggcgatcgc aatctggctc ccagttttgt gaatgaagat ggcgtcgaat
     5101 gacgccaacc catctgatgg gtccgcagcc aacctcgtcc cagaggtcag caatgaggtt
     5161 atggctttgg agcccgttgt cggtgccgct attgcggcgc ctgtagcggg ccaacaaaat
     5221 gtaattgacc cctggattag aaataatttt gtacaagccc ctggtggaga gttcacagta
     5281 tcccctagaa acgctccagg tgaaatacta tggagcgcgc ccttaggccc tgatctgaat
     5341 ccctacctat ctcatttggc cagaatgtat aatggttatg caggtggttt tgaagtgcag
     5401 gtgatcctcg cggggaacgc gttcaccgcc ggaaaaatta tatttgcagc agtcccacca
     5461 aattttccaa ctgaaggcct gagtcccagc caggtcacta tgttccccca cataatagta
     5521 gatgttaggc aattggaacc tgtgttgatc cccttacctg atgttaggaa taatttctat
     5581 cattataatc agacaaatga ttctaccatt aaattgatag caatgctgta tacaccactt
     5641 agggccaata atgctgggga agacgtcttc acagtctctt gtcgagtcct cactaggccg
     5701 tcccctgatt ttgattttat atttttggtg ccacccacag ttgagtcaag aactaaacca
     5761 tttactgtcc caatcttaac cgttgaagaa atgaccaatt caagattccc cattcctttg
     5821 gaaaagttgt tcacgggtcc cagcggtgcc tttgttgtcc aaccacaaaa tggcaggtgc
     5881 acgactgatg gcgtgctctt aggcaccacc caactgtctc ctgtcaacat ctgcaccttc
     5941 agaggggatg tcacccacat tgcaggttct cgtaattaca caatgaattt ggcatctcta
     6001 aattggaaca attatgaccc aacagaagaa attccagccc ctctaggaac tccagatttc
     6061 gtgggaaaga tccaaggtgt gctcactcaa accacaaaag gagatggctc gacccgtggc
     6121 cataaagcta cagtttacac tgggagtgct ccctttactc caaagctggg cagtgttcaa
     6181 ttcagtactg acacagaaaa tgattttgaa actcaccaaa acacaaaatt taccccagtc
     6241 ggtgtcatac aggacggtgg caccacccac cgaaatgaac cccaacaatg ggtgctccca
     6301 agttattcag gtagagatgt tcataatgta cacctagccc ctgctgtagc ccccactttt
     6361 ccgggtgaac aacttctttt cttcaggtcc actatgcccg gatgcagcgg gtatcccaac
     6421 atggatttgg attgcctact cccccaggag tgggtgcagc acttctacca agaggcagct
     6481 ccagcacaat ctgatgtggc tctattgaga tttgtgaatc cagacacggg cagggtcctg
     6541 tttgagtgca aacttcataa atcaggctat gtcacagtgg ctcacaccgg tcagcatgat
     6601 ttggtcatcc cccccaatgg ctattttagg tttgattcct gggttaatca gttttacaca
     6661 cttgccccca tgggaaacgg aacggggcgt aggcgcgctt tataatggct ggagctttct
     6721 ttgctggatt ggcatctgat gtccttggct ctggacttgg ttccctaatc aatgctgggg
     6781 ctggggctat caaccaaaag attgattttg aaaataatag aaaattgcag caagcttctt
     6841 tccagtttag cagtaatcta caacaggctt cctttcaaca cgataaagag atgctccaag
     6901 cacaaattga ggccactaaa aagttgcaac aggaaatgat gaaagtcaaa caggcaatgc
     6961 tcctagaagg tggattctct gaaacagatg cagcccgtgg ggcaatcaac gcccccatga
     7021 caaaggtttt ggactggagc ggaacaaggt actgggcccc tgatgctagg actacaacat
     7081 acaatgcagg ccgcttttcc acccctcaac cttcggggac gctgccagga agaaccaatc
     7141 ccaggactcc tacccccgct cggggctcct ccagcacatc ttctaatgct tctactgcta
     7201 cttctatact ttcaaatcaa actgcttcaa cgagacttgg ttctacagct ggttctggta
     7261 ccaatgtctc gagtctcccg tcaactgcaa ggactaggag ttgggttgag gatcaaaaca
     7321 gaaatttgtc acctttcatg aggggggctc ataacatatc gtttgtcacc ccaccatcta
     7381 gcagatcctc tagccaaggc acagtctcaa ccgtgcctaa agaagttttg gactcctgga
     7441 ctggcgcttt caacacgcgc aggcagcctc tcttcgctca cattcgtagg cgaggggagt
     7501 cacgggtgta a
//