Typing tool

Complete norovirus genomes

KC013592  GII.4 US95
 GII.P4 US95

Length: 7,556 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6704
ORF3: 6704..7510
LOCUS       KC013592                7556 bp    RNA     linear   VRL 11-MAR-2013
DEFINITION  Norovirus Hu/GII.4/HS191/2004/USA, complete genome.
ACCESSION   KC013592
VERSION     KC013592.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/HS191/2004/USA
  ORGANISM  Norovirus Hu/GII.4/HS191/2004/USA
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7556)
  AUTHORS   Sosnovtsev,S.V., Bok,K., Wang,Q., Saif,L.J. and Green,K.Y.
  TITLE     Complete Genome Sequence of GII.4 Human Norovirus HS191
  JOURNAL   Genome Announc 1 (1), E00169-12 (2013)
   PUBMED   23409259
REFERENCE   2  (bases 1 to 7556)
  AUTHORS   Sosnovtsev,S.V., Bok,K., Wang,Q., Saif,L.J. and Green,K.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-OCT-2012) LID, NIAID/NIH, 50 South Drive, B50/R6314,
            Bethesda, MD 20892, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Sequencher v. 4
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7556
                     /organism="Norovirus Hu/GII.4/HS191/2004/USA"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/HS191/2004/USA"
                     /host="Homo sapiens"
                     /db_xref="taxon:1268361"
                     /country="USA"
                     /collection_date="2004"
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AFZ84662.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEIVVSYSVKDGVSGLPELSTVRQPE
                     EANTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGMVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLKACKDLGAYGLEILKLVMKWFFP
                     KKDEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPDLTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PDLKQALKDISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSASVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTGEATNKDGC
                     LKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVAGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRENDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTVINVLEQTIDPPEKWSFTQACASLDKTTSSGHPHHMRKNDCW
                     NGDSFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPSFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6704
                     /note="ORF2"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AFZ84663.1"
                     /translation="MKMASNDASPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSAVNICTFRGDVTHIAGSHDYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTREDGSTRAHKATVSTGSVHFTPKLGSVQYTTDTNNDFQTGQNTKFTPVGVIQDG
                     NNHQNEPQQWVLPNYSGRTGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDC
                     LLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGPHDLVI
                     PPNGYFRFDSWVNQFYTLAPMGNGAGRRRVL"
     CDS             6704..7510
                     /note="ORF3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AFZ84664.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQGMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALPGRNNLRATVPARGSSSTLS
                     SIPTATSVYSNQTVSTRLGSSAGSGTSVSSLPSTARTRSWVEDQNKNLSPFMRGALNT
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgccaaca gcaacaacga
       61 caccgcaaaa tcttcaagcg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcccccccc gagggaaata ccacaaagac ccccacgacc
      181 acccacccca gaactggtca aaaagatccc ccctcccccg cccaacgggg aggatgaaat
      241 agtggtttct tatagtgtca aagatggcgt ttccggtttg cctgagcttt ccaccgtcag
      301 gcaaccggaa gaagccaaca cggccttcag tgtcccccca ctcaaccaga gggaaaatag
      361 agatgctaag gagccattga ctggaacaat tctggaaatg tgggatgggg agatctacca
      421 ttacggccta tatgtggagc gaggtcttat acttggtgtg cacaaaccac cagctgccat
      481 tagcctcgcc aaggtcgagc tgacaccact ctccttgttt tggagacctg tgtatactcc
      541 ccagtatctc atttctccag acactctcaa gaaattacac ggagaatcgt ttccctacac
      601 agcctttgac aacaattgtt atgccttctg ttgctgggtc ttggacctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac cggtttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgattc caaattaaag aaggtagcta atatattcct
      781 gtgtgctcta tcttcactat tcaccaggcc cataaaagac ataataggga agctaaggcc
      841 tcttaacatc cttaacatct tagcctcatg tgattggact ttcgcaggca tggtggaatc
      901 cttgatactc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg attacgagtt acaaggaccc gaggaccttg cagtggaact
     1021 cgttcctgta gtgatggggg gaattggtct ggtgctagga tttaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catccacctt aaaagcttgt aaagatcttg gtgcatacgg
     1141 gctggaaatc ctaaagttag tcatgaagtg gttcttccca aagaaagatg aagcaaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtgctggat ctcgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagtctggca acctacatga ggacccttga
     1321 ccttgaggag gagaaagcca gaaagctctc aaccaagtcc gcatcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc tgctgcacgt tccctggtgc atcgagcgaa
     1441 ggaggagctt tccagcagac cgagacctgt tgtcttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaggtggc caagagaatc gcagcctccc tcacaggaga
     1561 ccagcgcgta ggcctcgtcc cacgcaatgg cgtcgatcac tgggatgcat acaaggggga
     1621 gagggtcgtc ctatgggacg actatgggat gagcaatccc atccacgatg ccctcaggtt
     1681 gcaagaactc gctgacactt gccccctcac tctaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagtgatg tcataattat caccactaac ctggccaacc cagcaccact
     1801 ggactatgtc aactttgagg catgctcgag gcgcatcgat ttcctcgtgt atgcagaagc
     1861 ccctgaagtc gaaaaggcga aacgcgactt cccaggccaa cctgacatgt ggaagaacgc
     1921 tttcagttct gatttctcac acataaaact aacactggct ccacagggtg gcttcgataa
     1981 gaacgggaac accccacacg gaaagggcgt catgaagact ctcaccactg gctcccttat
     2041 tgcccgggca tcagggctac tccatgagag gctagatgag tttgaactac agggcccaga
     2101 tctcaccacc ttcaactttg atcgcaacaa agtgcttgcc tttaggcagc ttgctgctga
     2161 aaacaaatac gggttgatgg acacaatgaa agttggaagg cagctcaagg atgtcagaac
     2221 catgccagat cttaaacaag cactcaaaga tatctcaatc aagaagtgcc agatagtgta
     2281 cagtggttgc acctatacac ttgagtctga tggcaagggc aatgtgaaag ttgacagagt
     2341 tcagagcgcc tccgtgcaga ccaacaacga gctggccggc gccctacacc atctaaggtg
     2401 cgccagaatc aggtactacg tcaagtgtgt ccaggaggcc ctgtattcca tcatccaaat
     2461 tgctggagct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aagacctctg
     2521 gtccaagcca caagtggaag acacagggga ggctaccaac aaggacgggt gcctaaaacc
     2581 taaagatgat gaggagttcg tcatttcatc cgacgatatc aaaactgagg gcaagaaagg
     2641 gaagaacaag actggccgcg gcaagaagca cacagccttc tcgagcaaag gtctcagtga
     2701 tgaggagtac gacgagtaca agagaattag agaagaaaga aatggcaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaagacttc tgcgaagagg aggaggccaa gattcggcaa aggattttca ggccaacaag
     2881 gaaacaacgc aaggaggaaa gggcctctct cggtttagtc acaggttctg aaatcaggaa
     2941 aaggaaccca gatgatttca agcccaaggg gaaactgtgg gctgatgatg acagaagtgt
     3001 ggactacaat gagaaactca gttttgaggc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggct tttgggtctc tcccagtctg ttcataacat caacccatgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aagcaaattc agatacacaa
     3181 atcaggcgaa ttctgtcgct tgaggttccc aaaaccaatc aggactgatg tggcgggcat
     3241 gatcttagaa gaaggtgcgc ccgaaggcac cgtggtcaca ctactcatca agagacctac
     3301 tggagaactt atgcccctag cagctagaat ggggacccat gcaaccatga aaattcaagg
     3361 gcgcactgtt ggaggtcaga tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 cctaggcacc acaccaggtg actgcggctg cccctacatc tacaagaggg aaaatgacta
     3481 tgtggttatt ggggtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 ccaggggagt gagggggagg ctacacttga aggtggtgac agtaagggaa catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaactcagc accaagacca aattctggag
     3661 atcgtccact acaccactcc cacctggcac ctatgaacca gcctatcttg gtggtaagga
     3721 ccccagagtc aagggtggcc cttcattgca acaagttatg agggatcagt tgaaaccatt
     3781 tacagagccc aggggcaaac caccaaagcc aagtgtgttg gaagctgcca agaaaaccgt
     3841 catcaatgtc cttgaacaaa caatcgaccc acccgagaaa tggtcattca cgcaagcttg
     3901 cgcgtccctt gataagacta cttccagtgg ccacccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gattccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gttcgaagag gggaagaaca tgaccccagt ttacacaggt gcgcttaagg atgagttagt
     4081 taaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct cggacttagc
     4141 gaccatgatc cggtgcgctc gagcattcgg aggcttaatg gatgaactca aagcgcactg
     4201 tgttacactt cctatcagag ttggtatgaa tatgaatgag gacggcccca tcatcttcga
     4261 gagacattcc aggtacaaat atcactatga tgctgactac tctcggtggg attcaacaca
     4321 acagagagcc gtgttggcag cagccctaga aatcatggtt aaattctcct cagaaccaca
     4381 tttggctcag gtggtcgcag aagaccttct ttctcctagc gtggtggatg tgggtgactt
     4441 caaaatatca atcaatgagg gtctcccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc gctctctgaa gttacaaact tgtcccctga
     4561 catcatacag gctaattccc tcttctcctt ttatggtgat gatgaaattg ttagtacaga
     4621 tataaagttg gacccagaga aattgacagc aaaactcaag gaatacgggc tgaaaccaac
     4681 ccgccctgac aaaactgaag ggccccttgt tatttctgaa gatttaaatg gtctgacctt
     4741 cctgcggagg actgtgaccc gcgacccagc tggttggttt ggaaaattgg agcagagttc
     4801 aatactcaga caaatgtact ggactagggg tcccaaccat gaagacccat ctgaaacaat
     4861 gattccacat tcccaaagac ccatacaatt gatgtcccta ctgggagagg ccgcactcca
     4921 cggcccatca ttctacagca aaattagcaa gttggttatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgtttaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccag cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ctatcgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctccg ggtgagatac tatggagcgc gcccttgggc cctgatttga
     5341 acccctacct ttctcatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccgggaaaat catatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ttgagcccca gccaggttac tatgttcccc catataatag
     5521 tagatgttag gcaattggaa cccgtgttga tccccttacc tgatgttagg aataacttct
     5581 atcattataa ccaatcaaat gattctacca ttaaattgat agcaatgctg tatacaccac
     5641 ttagggctaa taatgctggg gatgatgtct tcacagtctc ttgtcgagtc ctcacgaggc
     5701 catcccccga ttttgatttc atattcttgg tgccacccac agttgaatca agaactaaac
     5761 cattcaccgt cccaatctta actgttgagg aaatgtccaa ctcaagattc cccattcctt
     5821 tggaaaagtt gtacacgggt cccagcagtg cttttgttgt ccaaccacaa aatggcaggt
     5881 gcacgactga cggcgtgctc ttaggcacta cccagctgtc tgctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac attgcaggca gtcatgacta tacaatgaat ttggcttctc
     6001 aaaattggaa caattatgac ccaacagaag aaatcccagc ccctctggga actccagatt
     6061 tcgtgggaaa gatccaaggc atgctcaccc aaaccacaag agaggatggc tcgacccgcg
     6121 cccacaaagc cacagtgagc actgggagtg tccactttac tccaaagctg ggcagtgttc
     6181 aatacaccac tgacacaaac aatgattttc aaactggcca aaacacgaaa ttcaccccag
     6241 tcggcgtcat ccaggacggt aataaccatc aaaatgaacc ccaacaatgg gtacttccaa
     6301 attactcagg tagaactggt cataatgtgc acctagctcc tgccgttgcc cccactttcc
     6361 cgggtgagca acttctcttc tttaggtcca ctatgcccgg gtgtagcggg tatcccaaca
     6421 tgaatctgga ttgcctactc ccccaggaat gggtgcagca cttctaccaa gaagcagccc
     6481 cagcacaatc tgatgtggct ctgctgagat ttgtgaatcc agacacaggt agggttctgt
     6541 ttgagtgcaa gctccataaa tcaggctatg tcacagtggc tcacactggc ccacatgatt
     6601 tggttatccc ccccaatggt tactttagat ttgattcctg ggtcaaccag ttctacacac
     6661 ttgcccccat gggaaatgga gcggggcgca gacgtgtatt ataatggctg gagctttctt
     6721 tgctggattg gcatctgatg tccttggctc tggacttggt tccctaatca atgctggggc
     6781 tggggccatc aaccaaaaag ttgaatttga aaataacaga aaattgcaac aagcttcttt
     6841 ccaatttagt agcaatctgc aacaggcttc cttccaacat gataaggaga tgctccaagc
     6901 acaaattgag gccactaaga aattgcaaca gggcatgatg aaggttaaac aggcgatgct
     6961 cctagagggt ggattctctg aaacagatgc agcccgtggg gcaattaacg cccccatgac
     7021 aaaggctctg gactggagcg gaacaaggta ctgggctcct gatgccagga ccacaacata
     7081 caatgcaggc cgcttttcca cccctcaacc ttcgggggca ttgccaggga gaaataacct
     7141 tagggccact gtccccgctc ggggctcctc tagcacactt tctagcattc ccactgctac
     7201 ttctgtgtat tcaaatcaaa ctgtttcaac gagacttggt tcttcagctg gttctggcac
     7261 cagtgtctcg agtcttccgt caactgcaag gactaggagc tgggttgagg atcaaaacaa
     7321 aaatttgtca cctttcatga ggggggctct caacacatca ttcgtcaccc caccatctag
     7381 tagatcctct agccaaggca cagtctcaac cgtgcctaaa gaaattttgg actcctggac
     7441 tggcgctttc aacacgcgca ggcagcctct cttcgctcac attcgcaagc gaggggagtc
     7501 acgggtgtaa tgtgaaaaga caaaattgat tatctttcct ttctttagtg tctttt
//