Typing tool

Complete norovirus genomes

JX989075  GII.6
 GII.P6

Length: 7,550 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6722
ORF3: 6722..7498
LOCUS       JX989075                7550 bp    RNA     linear   VRL 09-MAY-2014
DEFINITION  Norovirus Hu/GII.6/GZ2010-L96/Guangzhou/CHN/2011, complete genome.
ACCESSION   JX989075
VERSION     JX989075.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.6/GZ2010-L96/Guangzhou/CHN/2011
  ORGANISM  Norovirus Hu/GII.6/GZ2010-L96/Guangzhou/CHN/2011
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7550)
  AUTHORS   Xue,L., Wu,Q., Kou,X., Zhang,J. and Guo,W.
  TITLE     A simple and novel method for GII norovirus genome clone with
            generic primers
  JOURNAL   J. Appl. Microbiol. 115 (2), 613-620 (2013)
   PUBMED   23647661
REFERENCE   2  (bases 1 to 7550)
  AUTHORS   Xue,L., Wu,Q., Kou,X. and Zhang,J.
  TITLE     Rational design of generic primers used for genome clone of GII
            Norovirus
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7550)
  AUTHORS   Xue,L., Wu,Q., Kou,X. and Zhang,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-OCT-2012) State Key Laboratory of Applied
            Microbiology (Ministry-Guangdong Province Jointly Breeding Base),
            South China, Guangdong Provincial Key Laboratory of Microbial
            Culture Collection and Application, Guangdong Open Laboratory of
            Applied Microbiology, Guangdong Institute of Microbiology, No. 100,
            Xianliezhong Road, Yuexiu District, Guangzhou, Guangdong 510070,
            China
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: seqman v. 7.1.0
            Sequencing Technology :: 454
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7550
                     /organism="Norovirus
                     Hu/GII.6/GZ2010-L96/Guangzhou/CHN/2011"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.6/GZ2010-L96/Guangzhou/CHN/2011"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1282430"
                     /country="China"
                     /collection_date="14-Jan-2011"
                     /note="genotype: GII.6"
     CDS             5..5098
                     /note="ORF1; contains NTPase, 3A-like protein, VPg,
                     protease, and RdRp"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AGC96534.1"
                     /translation="MKMASNDATSAFGSQNSVNDSINTTPSNREEVGAFSNIKVGLKK
                     MLGAVPKNTKAPSGDQHCPTVKIGSKTLVIPPEPPNGEDIVQFDAKSETVRGLPDLTT
                     VQNEHENTPYTVPPLSEREHRPAAEPLPGTILEMWDGEFYHYSIYVSGGKALGVHKPP
                     AAISLATVELTPISLYWRPVYTPNYLVHPDTLKGLAGEKFPYTAFSNNCYNFCCWVLE
                     LNDTWLCRRSISRTTGFFKPYQSWNREPLPTIDDGKIKKVANAILCALGSLFSKPIKD
                     LLGKLKPLNLLHLLASCDWTFAGIVETVILMAELFNVFWTPPDVSNFIASLVGDFQLQ
                     GPEDLAVELVPVVMGGIGMVLGFTAEKIGRMLSSAASTLRACKDLGNYALDILKLVMK
                     WSFPKKEEKAEMETLRAIEDAVLDMEAIGNNHLTTLLKDKDSLTAFMKTLDLEEEKAR
                     KLSTKSSSPDIVGTINAILARIAAARSLLHKAKEEMFSRIRPVVVMISGRPGIGKTHM
                     ARHLAKSIANTMSGDQRVGLVPRNGVDHWDAYRGERVVLWDDYGMGNPVKDALTLQEL
                     ADTCPVTLNCDRIENKGKMFDSDVIIITTNLINPAPLDYVNFEACSRRIDFLVYAESP
                     EIEKVKRDFPGQPDMWKDHFKPDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSL
                     TARVAGLVHERRDEFQLQGDNLQTYNFDTNRVSAFRKLAADNKYGIMETMRVGAALKN
                     VKTLEDLRVALRDVKFNECEIIYKNTKYRVSSDGKGTVSVDKVEDLASQTASEVSSAL
                     LRLRQARARYYVSCFQDLVYTLIQVAGASFVVNRISKRFCWERWVKPADTQETSEPEK
                     EAAQSGWEIEPKDTEPEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEYKRIREERNGKY
                     SIEEYLQDRDRYYEEVAVARATEEDFCEEEEAKIRQRIFRPTRKQRKEERGVLGLVTG
                     TDIRKRRPDDFQPKGNLWADDTRSVDYNERLDFEAPPSVWSRIVPLGTGWGFWVSSNL
                     LITTTHVLPKGIKELFGVDVKQIQIHKSGEFCRFRFPKPIRPDVSGLVLEEGAPEGTV
                     CSILVKRPTGEMIPLAVRMGTHASMKIQGRTVGGQMGMLLTGANAKNMDLGTGPGDCG
                     CPYIYKRGNDIVVAGVHTAAARGGNTVICATQGQDGEAVLEGNESLGTYCGAPILGPG
                     KAPKLSTKTKFWRSSPDALPPGTYEPAYLGGKDPRVEKGPSLQQVMRDQLKPFTEPRG
                     KPPRPSVLEEAKKTVMNVLEQTIDPAKPWTYSQACASLDKTTSSGSPHHIRKNDHWNG
                     ESFTGPLADQASKANLMYEQAKHMQPVYTAALKDELVRTDKIYKKIKKRLLWGSDLGT
                     MVRCARAFGGLMDSMKASCIALPCRVGMNMNEDGPIIFDKHSKYRYHYDADYSRWDST
                     QQRNILSAAMEVMVRFSAEPELAQVVAEDLLAPSQLDVGDFVISVQEGLPSGVPCTSQ
                     WNSIAHWILTLSAMAEVSGLSPDVVQAHSCFSFYGDDEIVSTDINLDPSKLTQKLREY
                     GLVPTRPDKTEGPLVITEDLTGLTFLRRSIARDPAGWFGKLDQDSILRQLYWTRGPNH
                     ENPYESMVPHSQRATQLMALLGEASLHGPQFYKKVSKMVISEIKSGGLEFYVPRQEAM
                     FRWMRFSDLSTWEGDRNLAPESVNEDGVE"
     gene            5079..6722
                     /gene="VP1"
     CDS             5079..6722
                     /gene="VP1"
                     /note="ORF2"
                     /codon_start=1
                     /product="major viral capsid protein"
                     /protein_id="AGC96535.1"
                     /translation="MKMASNDAAPSNDGAANLVPEANNEVMALEPVVGASIAAPVVGQ
                     QNIIDPWIRENFVQAPQGEFTVSPRNSPGEMLLNLELGPELNPYLSHLSRMYNGYAGG
                     MQVQVVLAGNAFTAGKIIFAAVPPHFPVENISAAQITMCPHVIVDVRQLEPVLLPLPD
                     IRNRFFHYNQEDTPRMRLVAMLYTPLRANSGEDVFTVSCRVLTRPAPDFEFTFLVPPT
                     VESKTKPFTLPILTLGELSNSRFPAPIDMLYTDPNETIVVQPQNGRCTLDGTLQGTTQ
                     LVPTQICSFRGTLISQTSRSADSTDSAPRVRNHPLHVQLKNLDGTPYDPTDEVPAVLG
                     AIDFKGTVFGVASQRNTTGSSVGATRAHEVHIDTTNPRYTPKLGSVLMHSESSDFDDG
                     QPTRFTPIGMGADDWHQWELPEYSGHLTLNMNLAPAVAPAFPGERILFFRSVVPSAGG
                     YGSGQIDCLIPQEWVQHFYQEAAPSQSAVALIRYVNPDTGRNIFEAKLHREGFITVAN
                     SGNNPIVVPPNGYFRFEAWVNQFYTLTPMGTGQGRRRVQ"
     gene            6722..7498
                     /gene="VP2"
     CDS             6722..7498
                     /gene="VP2"
                     /note="ORF3"
                     /codon_start=1
                     /product="minor viral capsid protein"
                     /protein_id="AGC96536.1"
                     /translation="MAGAFFAGLAGDAITNGVGSLINAGANAINQKVEYDFNKQLQLA
                     SFKHDKEMLQSQVLATKQLQQEMMNIRQGVLTAGGFSPTDAARGAVNAPMTKILDWNG
                     TRYFAPNSMKTTSYSGQFSSNPVHRQPTLSRPDSQKVKINSDSASIYSSMSTAPSQST
                     HSMILTSGSGSSRTTSSPTVTSTLSRTSDWVRGQNERLSPFMDGALQTTFVTPPSSRA
                     SSNGSVSTVPKAVLDSWTPMFNTHRQPLFAHLRRRGESQI"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac ctctgccttt ggcagtcaaa actctgtcaa
       61 tgacagtatc aacaccaccc cttccaacag agaagaggtt ggtgcatttt ccaacatcaa
      121 agttggactt aagaaaatgc tgggtgccgt gcctaaaaac actaaagcgc ccagcggaga
      181 ccagcactgc cccacggtca agatcgggtc caaaacacta gtgatcccgc cggaaccccc
      241 aaacggcgag gatattgtac agttcgacgc aaaatcagaa actgtgcgtg ggctacccga
      301 cctgacgaca gtgcagaatg aacatgagaa caccccgtac acagttcctc cactaagtga
      361 aagggaacac aggccagccg ctgagccact ccccggcacg atactagaga tgtgggacgg
      421 tgaattctac cactactcca tctacgtcag cggaggcaaa gccttggggg tgcacaaacc
      481 cccagcggct ataagcctcg cgacagtgga gctcactccc atatcccttt actggcggcc
      541 tgtctacact ccaaactacc tggtccatcc agacacactg aagggccttg ctggagaaaa
      601 gtttccctac acggccttta gtaacaactg ctacaatttc tgttgctggg tacttgagct
      661 taacgacacg tggctttgca ggaggagtat atccaggacc accggcttct tcaagccata
      721 tcagtcttgg aacagggagc ccctccccac cattgatgat ggaaaaatca aaaaggtggc
      781 caatgcaatt ctctgcgcac ttggctcact attctcaaag ccaatcaaag acctactggg
      841 caaactcaag ccactcaacc tgctacatct gcttgcgtcg tgtgattgga cgtttgcagg
      901 tatagtagaa acagtcatct tgatggcgga actctttaat gtgttctgga ccccacctga
      961 tgtttccaat ttcatagcct ccttggtggg tgattttcag ttgcaaggac ccgaggactt
     1021 ggctgtggag ctggtccccg tggttatggg aggcataggg atggtcctcg gtttcactgc
     1081 cgagaagatt ggccgcatgt tgtcatctgc cgcgtcaact ctaagggcat gcaaagatct
     1141 agggaactat gccctggaca tactgaagct agttatgaag tggtcctttc caaagaaaga
     1201 agagaaggcc gaaatggaga ccttgagggc gattgaggac gccgtattag acatggaggc
     1261 aatagggaac aaccacctca caacactcct caaggacaag gacagcctca ctgcattcat
     1321 gaaaacccta gacctagagg aggagaaagc aaggaaattg tcaacgaagt catcatcacc
     1381 agacatcgtc ggcaccatta acgccatact ggctagaata gcagccgcta gatccctcct
     1441 acacaaggcc aaggaagaga tgttcagcag aattagacca gtggttgtca tgatttcagg
     1501 tagacctggc attggtaaaa cccatatggc aaggcatctg gctaagagca tagccaacac
     1561 aatgagtggg gaccagagag ttggacttgt cccgcgcaac ggggttgacc actgggatgc
     1621 ttacaggggg gagagagtgg tcctgtggga cgactacggt atggggaacc ctgttaaaga
     1681 tgccttgaca ctgcaagaac tggccgacac ctgtccagtc accttgaatt gtgataggat
     1741 tgaaaacaag gggaagatgt ttgacagtga tgtcatcata atcacgacca atttgatcaa
     1801 ccctgcacct cttgattatg ttaacttcga ggcttgctcc agaagaatcg acttccttgt
     1861 ctatgcagag tcaccagaaa tagaaaaggt caagagagac ttccctggtc agccagatat
     1921 gtggaaagat cacttcaaac cggatttttc ccacataaag ctaactttgg ccccccaggg
     1981 cgggtttgat aagaatggca acaccccaca tggtaaaggc accatgcgtt ctctgaccca
     2041 ggggtctctg actgcaagag tggcgggcct tgttcatgag aggagagatg agttccagct
     2101 gcaaggagat aacctacaga catacaactt tgacaccaat agggtctctg cgttcaggaa
     2161 actagccgca gataacaagt atggaatcat ggagacaatg agagtgggtg cagcactcaa
     2221 gaatgtcaag accttggaag acctcagagt tgctttgaga gatgtaaaat tcaatgaatg
     2281 tgagatcatc tacaagaaca ccaagtaccg ggtctcatct gatggtaaag gcacagtctc
     2341 tgttgacaaa gtcgaggacc tcgcttccca aaccgcaagc gaggtgagct cagccctcct
     2401 caggctcaga caagccaggg ccagatatta tgtcagctgt ttccaggacc ttgtctacac
     2461 tcttatacag gttgctgggg cttcatttgt cgtcaacaga atctccaaga ggttctgctg
     2521 ggaaagatgg gttaaaccgg ccgataccca ggagacgagt gagcccgaga aggaagctgc
     2581 ccagagtgga tgggagattg aacccaagga cacagaacca gagggtaaga agggcaagaa
     2641 caagaaagga aggggcaaga aacacacagc cttctccagc aaaggcctga gtgatgaaga
     2701 gtatgatgag tacaaaagga ttagggaaga aagaaatgga aagtactcca ttgaggaata
     2761 ccttcaagac cgtgaccgct actacgaaga agtagcagtt gcccgagcaa cagaggagga
     2821 tttctgtgaa gaggaggaag ccaagataag gcaaagaatt ttccgcccaa caaggaagca
     2881 aagaaaagag gaaaggggtg tgctcggcct ggtcactggc acagatatca ggaagagaag
     2941 accggatgac ttccaaccaa agggcaattt gtgggcagat gacactagga gtgtggacta
     3001 caacgagaga cttgatttcg aggccccccc aagcgtgtgg tcaaggatag tcccactggg
     3061 caccggctgg ggcttctggg tctcatccaa tctcctaatc acaacaacac atgttctgcc
     3121 caagggtatt aaggaacttt ttggcgttga cgtcaaacaa atccaaatcc acaaatctgg
     3181 agaattttgc aggtttagat tcccaaaacc aatcagacca gacgtctcag ggcttgtgtt
     3241 ggaagagggt gcgccagagg gcactgtctg ctccatactc gtgaagagac caacaggtga
     3301 gatgatccct ctagcggtga ggatgggcac acatgcatct atgaaaatcc agggcaggac
     3361 tgttggtgga caaatgggca tgctccttac tggggcaaac gcaaagaaca tggaccttgg
     3421 aaccggccca ggggattgcg gttgccctta tatttacaag agaggcaatg acatagtcgt
     3481 ggcaggtgtc cataccgcgg cggcccgagg aggcaacaca gtcatctgtg ccactcaggg
     3541 gcaggacggg gaagcagttc tcgaagggaa tgagagcctt ggcacttact gtggtgcccc
     3601 aatcctaggt cctggcaagg cgcccaagct cagtacgaag accaagtttt ggcgctcatc
     3661 gcctgatgcc ctgccacccg gcacatatga acctgcctac ctaggaggca aagaccccag
     3721 agtggagaag ggtccttccc tgcagcaagt catgagggat caattaaaac ctttcacaga
     3781 acccagaggt aaaccaccaa gaccctcagt cctggaagaa gctaagaaga cagtaatgaa
     3841 cgtcctggaa cagaccattg accctgctaa accatggact tactcacaag catgtgcttc
     3901 cctggataag accacttcca gtggcagccc ccaccacatc agaaagaacg accattggaa
     3961 tggagagtct tttacaggcc ctctcgcaga ccaagcatcc aaagctaatc tcatgtatga
     4021 gcaggccaaa cacatgcagc ctgtgtacac agctgcactc aaggatgagc tcgttagaac
     4081 tgacaaaatt tataagaaga taaagaagag gctcctgtgg gggtcggacc ttggcacgat
     4141 ggtcaggtgc gccagggcct ttggtggtct catggacagc atgaaagcaa gttgcatagc
     4201 cctcccgtgt agagtgggaa tgaacatgaa tgaggatgga cccatcattt ttgacaagca
     4261 ctccaaatat agataccatt atgatgctga ctactctagg tgggactcaa cccaacaaag
     4321 gaacatcttg tccgccgcca tggaagtgat ggtgcggttc tccgcggagc cagaattggc
     4381 acaagtagtc gcagaggacc tcttggcacc tagccagctg gacgttggcg actttgtcat
     4441 ctcagttcag gaaggcctgc catcaggagt cccatgcacg tcacaatgga attcaatagc
     4501 ccactggatc ttgaccttga gtgcgatggc agaggtgtca ggcctttcac cagatgttgt
     4561 gcaggcccat tcctgtttct ctttctatgg tgatgatgag attgtgagca ctgacatcaa
     4621 ccttgacccc tcaaaactga cacagaaact cagggagtac ggtctggtcc ccacacgacc
     4681 tgacaaaact gaaggccccc tggttataac tgaggacctc accggcctaa cattcctgcg
     4741 caggtcgatc gcgcgggatc ccgctgggtg gtttgggaag ctggaccaag actcaatcct
     4801 cagacagttg tactggacaa gagggcccaa ccatgagaac ccatacgaaa gtatggtccc
     4861 ccattcccag cgggccacac aactcatggc ccttcttgga gaagcctcac tacacggacc
     4921 ccaattctac aagaaggtca gtaagatggt cataagtgag atcaagagtg gtggtctgga
     4981 gttttatgtg cccagacaag aggccatgtt taggtggatg agattctctg acctcagcac
     5041 atgggagggc gatcgcaatc ttgctcccga gagtgtgaat gaagatggcg tcgaatgacg
     5101 ctgctccatc gaatgatggt gctgccaacc tcgtaccaga ggccaacaat gaggttatgg
     5161 cacttgaacc ggtggtggga gcctcaattg cagctcctgt cgtcggtcaa cagaatataa
     5221 ttgacccctg gattagagaa aattttgttc aggcaccaca gggtgagttt actgtttcac
     5281 caagaaactc gcctggtgag atgcttttaa atcttgaatt aggcccagag ctcaatcctt
     5341 acttgagtca tttgtcccgc atgtacaatg gttatgctgg tggcatgcag gttcaggtgg
     5401 tcctagctgg gaatgcgttc acagctggta aaatcatctt tgccgccgtt ccaccacatt
     5461 tccctgtaga gaatattagt gcagctcaaa ttacaatgtg cccccatgtg attgttgatg
     5521 tgagacagct tgaacctgtg cttttgcccc tccctgacat aaggaacaga ttctttcatt
     5581 acaaccagga agacaccccc cggatgagac ttgtggccat gttgtacaca cctcttagag
     5641 caaactctgg tgaggacgtg ttcactgtgt cttgcagagt cttgacccgc ccagcccctg
     5701 attttgagtt cacattctta gtgccaccaa ccgtggaatc aaagactaag ccttttacac
     5761 tccctatttt aaccctaggg gaactatcca attccagatt ccctgctcca atagacatgc
     5821 tgtacacaga tcctaatgag acaattgtgg tacaaccaca aaatggtaga tgcaccctag
     5881 atgggacact ccaagggacc acccagctgg tgcccaccca aatttgctct tttaggggca
     5941 cgttgatcag ccaaacgtcg aggtcagcag attcaacaga ctcagctcca cgggtgagga
     6001 accaccccct tcacgttcag ctgaagaacc tcgacgggac accatatgac ccaacagatg
     6061 aggtgccggc agttctgggt gccatagact ttaaaggaac tgtgtttgga gtcgctagcc
     6121 agaggaacac tacagggagc tctgtagggg cgactcgtgc ccatgaggtg cacatagaca
     6181 ccacaaaccc tagatacacc ccaaaacttg gttctgtgtt gatgcattct gagtctagtg
     6241 attttgatga tggacaacca acccgcttca cacccattgg catgggagca gatgattggc
     6301 accaatggga attgcccgaa tattcaggtc accttactct caacatgaac ctagcccctg
     6361 cagttgctcc tgctttcccc ggtgagcgca tcctcttctt taggtcagtg gttccatctg
     6421 ctggtggcta cggatcaggc caaatagact gcctcatccc acaggagtgg gttcagcact
     6481 tctatcagga ggccgcccct tcacaatctg cggtggctct tattagatat gttaaccctg
     6541 acactgggag aaacatcttt gaggcaaagc tacacagaga agggttcatt actgtggcaa
     6601 attctggaaa caaccccata gttgtgcccc cgaatggcta ttttaggttt gaggcctggg
     6661 tcaatcaatt ctacacactc acccccatgg gaactggaca ggggcgcagg agagtccaat
     6721 aatggcagga gctttctttg caggacttgc aggtgacgcc ataacgaatg gtgtcgggtc
     6781 cctgatcaac gctggggcca atgcaatcaa ccagaaggtg gagtatgatt tcaacaaaca
     6841 actccaattg gcatctttta agcatgacaa ggagatgctg caatcacaag ttctagccac
     6901 caaacaactc cagcaggaaa tgatgaacat aaggcaaggg gtcttgaccg ctggcggctt
     6961 ttcccctact gatgccgcga ggggcgctgt aaacgcgcca atgacaaaga tcctggattg
     7021 gaatggtaca agatattttg ccccaaatag catgaaaaca accagttatt caggtcagtt
     7081 ttccagtaat cctgtgcata ggcaacccac tttgtcccgt cctgattccc aaaaagtcaa
     7141 aattaatagt gattctgcta gtatatatag ttctatgtct actgctcctt cacaatcaac
     7201 ccattcaatg attctgactt cagggtctgg atcgtccagg acaacctcct ctcccacagt
     7261 gacttccacc ctatctagga ccagtgactg ggtgaggggg caaaatgaga ggcttagccc
     7321 gttcatggat ggtgctctcc aaacaacttt tgtcacacca ccatcgagca gagcttcatc
     7381 aaatgggtcg gtctcgaccg ttcccaaagc tgttttggac tcctggactc ctatgttcaa
     7441 tacccatagg cagcctctct tcgctcactt gcgtaggcga ggggagtcac aaatttagtg
     7501 aaaagattga tcaggttttc ttcttccttc tttctccttt tctttctttt
//