Typing tool

Complete norovirus genomes

JX846927  GII.6
 GII.P7

Length: 7,534 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6731
ORF3: 6731..7510
LOCUS       JX846927                7534 bp ss-RNA     linear   VRL 07-FEB-2014
DEFINITION  Norovirus Hu/GII.6/CHDC4073/1984/USA, complete genome.
ACCESSION   JX846927
VERSION     JX846927.1
DBLINK      BioProject: PRJNA70471
KEYWORDS    .
SOURCE      Norovirus Hu/GII.6/CHDC4073/1984/USA
  ORGANISM  Norovirus Hu/GII.6/CHDC4073/1984/USA
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7534)
  AUTHORS   Madupu,R., Halpin,R., Ransier,A., Fedorova,N., Stockwell,T.,
            Amedeo,P., Bishop,B., Edworthy,P., Gupta,N., Katzel,D., Li,K.,
            Schobel,S., Shrivastava,S., Thovarai,V., Wang,S., Kim,M., Bok,K.,
            Sosnovtsev,S.V., Wentworth,D.E. and Green,K.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2012) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: clc_ref_assemble_long v. 3.22.55705
            Coverage              :: 46.8x
            Sequencing Technology :: Sanger; Illumina; 454
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7534
                     /organism="Norovirus Hu/GII.6/CHDC4073/1984/USA"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.6/CHDC4073/1984/USA"
                     /host="Homo sapiens"
                     /db_xref="taxon:1260944"
                     /country="USA: District of Columbia"
                     /collection_date="08-Dec-1984"
                     /note="genotype: II.6"
     gene            5..5098
                     /gene="POL"
     CDS             5..5098
                     /gene="POL"
                     /note="genome polyprotein"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AFX71664.1"
                     /translation="MKMASNDATAAFGSQNSVNDSTNTTPSNKEEVGALSNIKVGFKK
                     MLGAVPKSTKAPSSDQHRPTVKIGPKTLVVPPEPPNGEDTIQFDAKSETISGLPDLTT
                     VQNEHENTPYTVPPLSEREHRPATEPLPGTILEMWDGEFYHYSVYVSGGKALGVHKPP
                     AAISLATIELTPISLYWRPVYTPNYLVCPDTLKGLAGEKFPYTAFSNNCYNFCCWVLE
                     LNDTWLSRRSISRTTGFFKPYQSWNRKPLPTVDDGKIKKVANAILCALGSLFSKPIKD
                     LLGKLKPLNLLHLLASCDWTFAGIVETVILMAELFNVFWTPPDVSNFIASLIGDFELQ
                     GPEDLAVELVPVVMGGVGMVLGFTAEKIGRMLSSAASTLRACKDLGNYALDILKLVMK
                     WFFPKKEEKAEMETLRAIEDAVLDMEAIGNNHLTTLLKDKDSLTAFMKTLDLEEEKAR
                     KLSTKSSSPDIVGTINAILARIAAARSLLHKAKEEMFSRIRPVVVMISGRPGIGKTHM
                     ARHLAKSIANTMSGDQRVGLVPRNGVDHWDAYRGERVVLWDDYGMGNPVKDALTLQEL
                     ADTCPVTLNCDRIENKGKMFDSDVIIITTNLVNPAPLDYVNFEACSRRVDFLVYAESP
                     EVEKVKRDFPGQPDMWKDHFKPDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSL
                     TARVAGLVHERRDEFQLQGNDLQTYNFDTNRVSAFRKLAADNKYGIMETMRVGAALKN
                     VKTLEDLKVALRDVKFNECEIIYRNSKYRVSSNGKGSVSVDKVEDHASQTENEVSSAL
                     LRLRQARARYYVSCFQDLVYTLIQVAGASFVVNRISKRFCWERWVKPTETQEANEVEK
                     EVAQGKWEIEPKDTEPEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEFKRIREERNGKY
                     SIEEYLQDRDRYYEEVAVARATEEDFCEEEEAKIRQRIFRPTKKQRKEERGVLGLVTG
                     SDIRKRRPDDFQPKGKLWADDTRSVDYNERLDFEAPPSVWSRIVPLGTGWGFWVSSNL
                     LITTTHVLPKGVKELFGVEIKQIQIHKSGEFCRFRFPRPIRPDVTGLVLEEGAPEGTV
                     CSILIKRPTGEMIPLAVRMGTHASMKIQGRTVGGQMGMLLTGANAKNMDLGTGPGDCG
                     CPYIYKRGNDIVVAGVHTAAARGGNTVICATQGQDGEAVLEGNEDLGTYCGAPILGPG
                     KAPKLSTKTKFWRSSPDALPPGTYEPAYLGGKDPRVEKGPSLQQVMRDQLKPFTEPRG
                     KPPRPAVLEEAKKTVMNVLEQTIDPAKPWTYSQACASLDKTTSSGSPHHVKKNDHWNG
                     ESFTGPLADQASKANLMYEQAKHMQPVYTAALKDELVKTDKIYKKIKKRLLWGSDLGT
                     MIRCARAFGGLMDSMKASCIALPCRVGMNMNEDGPIIFDKHSKYRYHYDADYSRWDST
                     QQRSILSAAMEVMVRFSAEPELAQVVAEDLLAPSQLDVGDFVISVQEGLPSGVPCTSQ
                     WNSIAHWILTLSAMAEVSGLSPDVVQAHSCFSFYGDDEIVSTDINLDPMKLTQKLREY
                     GLVPTRPDKTEGPLVITEDLTGLTFLRRSIARDPAGWFGKLDQDSILRQLYWTRGPNH
                     ENPYESMVPHSQRATQLMALLGEASLHGPQFYKKVSKMVINEIKSGGLEFYVPRQEAM
                     FRWMRFSDLSTWEGDRNLAPEGVNEDGVE"
     mat_peptide     5..1006
                     /gene="POL"
                     /product="protein p48"
     mat_peptide     1007..2104
                     /gene="POL"
                     /product="NTPase"
                     /note="p41"
     mat_peptide     2105..2623
                     /gene="POL"
                     /product="protein p22"
     mat_peptide     2624..3022
                     /gene="POL"
                     /product="viral genome-linked protein"
                     /note="VPg"
     mat_peptide     3023..3565
                     /gene="POL"
                     /product="3C-like protease"
                     /note="3CLpro; calicivirin"
     mat_peptide     3566..5095
                     /gene="POL"
                     /product="RNA-directed RNA polymerase"
     gene            5079..6731
                     /gene="VP1"
     CDS             5079..6731
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="AFX71665.1"
                     /translation="MKMASNDAAPSNDGAANLVPEANNEVMALEPVVGASIAAPVVGQ
                     QNIIDPWIRENFVQAPQGEFTVSPRNSPGEMLLNLELGPELNPYLSHLSRMYNGYAGG
                     MQVQVVLAGNAFTAGKIIFAAVPPHFPVENISAAQITMCPHVIVDVRQLEPVLLPLPD
                     IRNRFFHYNQENTPRMRLVAMLYTPLRANSGEDVFTVSCRVLTRPAPDFEFTFLVPPT
                     VESKTKPFTLPILTLGELSNSRFPAAIDMLYTDPNESIVVQPQNGRCTLDGTLQGTTQ
                     LVPTQICAFRGTLISQTARAADSTDSPQRARNHPLHVQVKNLDGTQYDPTDDIPAVLG
                     AIDFQGTVFGVASQRDVSGQQEQGHYATRAHEAHIDTTDPKYAPKLGTILIKSDSDDF
                     NTNQPIRFTPVGMGDNNWRQWELPDYSGRLTLNMNLAPAVSPSFPGERILFFRSIVPS
                     AGGYGSGYIDCLIPQEWVQHFYQEAAPSQSAVALVRYVNPDTGRNIFEAKLHREGFLT
                     VANSGNNPIVVPPNGYFRFEAWVNQFYTLAPMGSGQGRRRAQ"
     gene            6731..7510
                     /gene="VP2"
     CDS             6731..7510
                     /gene="VP2"
                     /note="minor capsid protein"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="AFX71666.1"
                     /translation="MAGAFFAGLAGDVVSNGIGSLINAGANAVNQKVEYDFNKQLQMA
                     SFKHDKEMLQSQVLATKQLQQEMMNIRQGVLTAGGFSPADAARGAVNAPMTKILDWNG
                     TRYWAPNSMKTTSYSGQFSSSPVHRPPAAPQHTAPPKSKLQGDSVSVYSSPSTVSSQS
                     THSTVLSAGTGSSRSTSTSTAASTLSRTSDWVRGQNERLSPFMDGALQTTFVTPPSSK
                     ASSNGTVSTVPKAVLDSWTPTFNTHRQPLFAHLRRRGESQI"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgctgccttt ggcagtcaaa actctgtcaa
       61 tgacagtacc aacaccaccc cttctaacaa agaagaggtt ggtgcattat ccaacatcaa
      121 agttggattt aagaaaatgc tgggtgccgt acccaagagc accaaagcac ccagcagtga
      181 tcagcatcgc cccacagtta agatcgggcc taaaacatta gtagtccctc ctgagccccc
      241 aaatggtgaa gacaccatac agtttgatgc gaagtcagaa actataagtg ggctaccaga
      301 tttaacaacg gtgcaaaatg aacacgagaa caccccttac actgtccctc cattgagtga
      361 gagggaacac agaccagcca ctgagccact tcctggcaca atattggaga tgtgggatgg
      421 tgaattctac cactattccg tgtacgtcag cggcggcaaa gctctagggg ttcacaaacc
      481 tccagcagct ataagcctcg cgacgataga gctcaccccc atatctcttt actggaggcc
      541 cgtttacacc cccaactact tggtctgccc agacacattg aagggtcttg ctggtgaaaa
      601 gttcccctac acggctttca gtaacaactg ttataacttc tgttgctggg tgcttgagct
      661 caatgacaca tggcttagca gaagaagcat ctccagaact accggcttct tcaaaccata
      721 ccagtcttgg aacaggaagc ctcttccaac cgttgatgac gggaagatca aaaaggtggc
      781 caacgcaatc ctctgtgcac tcggctcgct gttttcaaaa ccaatcaaag acctgttagg
      841 caagcttaaa ccattgaacc tgttacactt gctcgcgtca tgtgattgga cgtttgcggg
      901 tatagtggag acagttatct taatggcgga acttttcaat gtcttttgga ctccgccaga
      961 tgtctctaat ttcatagcct ccctgatagg tgactttgaa ttgcaagggc ctgaggacct
     1021 ggctgtggag cttgttcccg tggtcatggg tggtgtagga atggttctcg gcttcaccgc
     1081 tgagaagata ggccgcatgc tgtcatccgc tgcatcaaca ctgcgagcat gcaaagacct
     1141 agggaactat gcccttgaca tactcaaatt ggtcatgaag tggttcttcc caaagaaaga
     1201 agagaaagcc gagatggaaa ccttaagggc gattgaggat gccgtcctag atatggaagc
     1261 catagggaac aaccatctca cgaccctcct caaggacaag gacagcctca cggccttcat
     1321 gaagactttg gacctagaag aggagaaggc aaggaaattg tccactaaat catcctctcc
     1381 ggacatcgtc ggcactatca atgccatact ggcaaggata gctgccgcca gatccctcct
     1441 acacaaggcc aaagaagaaa tgttcagtag gatcagacca gtggttgtca tgatatcagg
     1501 caggcctggc attggcaaaa cccatatggc aagacacttg gctaagagca tcgccaacac
     1561 catgagtggc gaccagaggg tcgggctcgt tccgcgcaac ggggtcgacc actgggacgc
     1621 ctacagggga gagagggtgg tcttatggga tgactacggt atggggaacc ctgttaaaga
     1681 tgctttgaca ctacaagaac tggccgacac ctgcccagtc actctaaatt gtgataggat
     1741 cgagaacaag gggaagatgt tcgacagtga tgtcatcata atcacgacca acctagtcaa
     1801 ccctgcgccc ctcgattatg tgaacttcga ggcgtgctcc aggagagttg acttcttggt
     1861 ctatgcagag tcaccagaag ttgaaaaggt taagagagat ttccctggcc aacctgacat
     1921 gtggaaagac cactttaagc cagacttttc ccacataaag ttgaccctag ccccccaggg
     1981 tgggtttgac aagaatggta acaccccgca tggcaagggc accatgcgat ccctaaccca
     2041 gggatccctg actgcgcgag ttgcaggcct tgttcatgag aggagagatg agttccagct
     2101 ccaagggaac gacctccaaa cgtacaactt tgacaccaac agggtctccg cattcaggaa
     2161 gctggctgca gacaacaagt atggaattat ggaaacaatg agagtgggtg cggcactcaa
     2221 aaatgtcaag actttggaag acctgaaagt cgccttgagg gatgtaaaat tcaatgagtg
     2281 tgaaataatt tacaggaact ctaagtatcg agtctcttcc aacggtaagg gctctgtttc
     2341 tgttgataaa gttgaggatc atgcatccca gactgaaaat gaggtgagct cagcacttct
     2401 caggctcaga caagcaaggg ccagatatta tgtcagctgc ttccaagacc tcgtctacac
     2461 tctcatacag gttgccgggg catcattcgt tgttaacagg atctccaaaa ggttctgctg
     2521 ggagaggtgg gtcaaaccaa ccgagaccca agaagcgaat gaagtcgaaa aggaagtagc
     2581 tcaaggtaaa tgggagattg aacccaagga cacagaacca gaaggcaaga agggcaagaa
     2641 caagaaagga agaggcaaga aacacacagc tttctccagt aaaggcctga gtgatgaaga
     2701 gtatgacgag ttcaagagaa tcagggaaga aaggaacgga aaatactcca ttgaggaata
     2761 cctgcaagac cgggaccgct actacgaaga agtggcagtt gcccgggcaa cagaggagga
     2821 cttctgtgaa gaggaagagg ccaagataag acaaagaatc ttccgcccga caaagaaaca
     2881 gagaaaggag gaaagggggg tgctaggctt ggtcaccggc tcagacatca gaaagaggag
     2941 accagacgat ttccaaccaa aaggtaaact gtgggcagac gacaccagaa gtgtggatta
     3001 caatgagaga cttgatttcg aggctccccc aagtgtctgg tcgagaatag tcccattagg
     3061 cactggttgg ggtttctggg tttcatccaa cctcctgatc acaacaacac atgtcttgcc
     3121 taagggggtt aaggaactct ttggagttga aattaaacaa atccaaatcc acaaatctgg
     3181 agagttctgc aggtttagat ttccaagacc aatcaggcca gacgtcacag gactcgtgtt
     3241 ggaggaaggc gctccagaag gcactgtctg ttccatactc ataaagagac ctacaggtga
     3301 gatgatcccc ctggcagtga ggatgggcac gcatgcatcc atgaaaatac agggtaggac
     3361 cgttggtggc cagatgggga tgcttctcac aggggcaaac gcgaagaaca tggatcttgg
     3421 caccggtcct ggtgactgcg gttgtcctta catctacaag cgcggcaatg acatagttgt
     3481 cgcgggtgtc cacaccgcag cagcccgggg gggcaacact gtcatatgtg ccactcaagg
     3541 gcaagatgga gaggcagtcc ttgaggggaa tgaggacctc ggcacttact gcggtgctcc
     3601 aatcctgggc cctggcaagg cgcctaaact cagcacgaag accaaattct ggcgttcatc
     3661 accagatgcc ttgccacctg gcacatatga acctgcttac ctgggaggca aggaccctag
     3721 agtggagaaa ggaccctccc tgcagcaagt catgagagat cagctaaagc cctttacaga
     3781 gcccaggggc aaaccaccta gacctgcagt cttagaagaa gctaaaaaga cagtgatgaa
     3841 tgttctagaa caaaccattg accctgctaa gccatggacc tactcgcaag catgtgcctc
     3901 actggacaaa accacttcca gtggtagccc ccaccatgtc aagaaaaatg accattggaa
     3961 tggggagtcc ttcactggtc cccttgcaga tcaagcatct aaagccaacc tcatgtatga
     4021 acaggccaaa catatgcagc ccgtgtacac ggccgcgctc aaagatgagc ttgttaagac
     4081 tgacaagatc tacaaaaaga taaagaagag gctcctatgg gggtctgacc ttggcacaat
     4141 gatcaggtgc gccagggctt ttggcggtct catggacagc atgaaggcaa gttgcatagc
     4201 tcttccatgc agagtgggaa tgaacatgaa tgaagatggc cccatcatat ttgacaaaca
     4261 ctctaagtac aggtatcact atgatgctga ctattctagg tgggattcaa ctcagcaaag
     4321 gagcattctc tctgccgcta tggaagtgat ggtgcggttt tctgctgaac cagaattggc
     4381 acaagtagtt gcagaggacc ttttggcacc tagccagcta gatgttggcg attttgtcat
     4441 ctcagtccag gagggtctgc catcaggagt cccatgcaca tcacagtgga attcaatagc
     4501 acactggatc ctaactttga gtgcaatggc agaagtgtca ggtctctcac cagatgttgt
     4561 ccaagcccac tcctgctttt cattttatgg tgatgatgag atcgttagca ctgacatcaa
     4621 ccttgacccc atgaaattga cacagaaact cagggagtac ggtctggttc ccacccgacc
     4681 tgataaaact gaaggccccc tcgtcataac tgaagacctc accggcctga cgttcctacg
     4741 taggtcgatt gcacgggatc cggctgggtg gtttggaaaa ttggaccagg actcaattct
     4801 caggcaatta tactggacaa gggggcccaa tcatgagaac ccatacgaga gcatggtccc
     4861 ccattctcag cgggccacac agctcatggc ccttcttggt gaggcttcac tgcatggtcc
     4921 ccagttttac aagaaagtta gcaagatggt catcaatgag atcaagagtg gtggtctgga
     4981 attttatgtg cccagacaag aggccatgtt taggtggatg agattctctg acctcagcac
     5041 atgggagggc gatcgcaatc ttgctcccga aggtgtgaat gaagatggcg tcgaatgacg
     5101 ctgctccatc gaatgatggt gctgccaacc tcgtaccaga ggccaacaat gaggttatgg
     5161 cacttgaacc ggtggtggga gcctcaatcg cagctcctgt tgtcggtcag caaaatataa
     5221 ttgacccctg gattagagaa aattttgtcc aagcaccaca gggcgagttc actgtttcac
     5281 caaggaattc gcctggtgag atgctcttaa atcttgagct gggcccagaa cttaatccct
     5341 atttgagtca tttgtcccgc atgtacaacg gatatgctgg tggcatgcag gttcaggtgg
     5401 tcctagctgg gaatgcgttc acagctggga aaatcatctt tgccgccgta ccaccacatt
     5461 tccctgtaga aaacatcagt gcagcccaga taactatgtg tccccatgtg attgttgatg
     5521 tgagacagct tgaaccagtg cttttgcccc tccctgatat aagaaatagg ttcttccatt
     5581 acaaccagga gaacaccccc cggatgaggc tcgtagccat gctctataca cctctaaggg
     5641 ccaattctgg cgaggatgtg ttcactgtgt cctgtagggt tctgactcgc cccgctccag
     5701 attttgagtt cacattttta gtgccaccaa ctgtcgaatc aaaaacaaaa ccctttactt
     5761 tacctatcct aacccttggt gagttgtcta actcccgctt tccggctgct atagatatgc
     5821 tttacactga ccccaatgag tcaatagttg tacagcccca aaatggtagg tgcactcttg
     5881 atggcacctt gcaaggcaca acacaattag ttcccacaca gatttgtgct tttagaggta
     5941 ccctgatcag ccaaaccgcg agagcggctg actcaacaga ctccccccag agagcccgta
     6001 atcatccatt acacgtccag gtcaagaacc tagacggcac acagtacgac ccaacggatg
     6061 atatacctgc agtccttggg gctattgact tccaaggcac agtctttgga gtggctagtc
     6121 agagggatgt ctctggacaa caagaacagg gccactatgc caccagagcc catgaagcac
     6181 acattgacac aactgaccca aagtatgcac ccaaattggg cacaattctt attaaatctg
     6241 attctgatga ttttaataca aatcagccca ttaggttcac tccggtgggc atgggtgaca
     6301 acaattggag acagtgggaa ttacccgatt attctggcag actaaccttg aatatgaacc
     6361 tagcccctgc cgtttctcca tccttccctg gtgaacgaat ccttttcttc aggtctatag
     6421 taccatcagc cggcggctac gggtctggtt atatagactg tctcataccc caggaatggg
     6481 tacaacactt ctaccaggaa gcagcgcctt cacaatctgc cgttgcactg gttaggtatg
     6541 tcaatcccga tactgggcgt aacatctttg aggccaagtt acacagagaa ggcttcctca
     6601 ccgtggccaa ttctggaaac aacccaattg tggtcccccc caatggttat tttaggtttg
     6661 aggcttgggt taatcagttt tacacacttg cccccatggg atctggacag gggcgtagaa
     6721 gggcccagta atggctggag ccttcttcgc agggttagca ggtgatgtcg tgtcgaacgg
     6781 catcggatcc cttattaatg caggtgccaa tgcagttaat caaaaggttg agtatgattt
     6841 taataagcaa cttcagatgg catcatttaa acatgacaag gagatgctac aatcacaggt
     6901 gctggcaacc aaacaactgc agcaggagat gatgaacata aggcaggggg tgttgaccgc
     6961 tggcggcttc tcccctgcgg atgctgctag aggggctgtt aatgctccaa tgacgaagat
     7021 actggactgg aatggcacaa gatattgggc accaaacagc atgaaaacca caagctattc
     7081 aggacagttc tctagtagcc ctgtacacag acctcctgct gctccccagc atactgctcc
     7141 accaaaaagt aagttgcaag gtgattctgt tagtgtatat agttctccct ctactgtttc
     7201 ttcacaatca acccattcaa cagtgctgtc tgcaggaact gggtcatcca ggtccacctc
     7261 cacgtccaca gcagcctcca ccttgtctcg gaccagtgac tgggttaggg gtcagaatga
     7321 aaggcttagc ccgtttatgg atggtgccct ccaaactacc tttgtcacac caccatcgag
     7381 caaagcttca tcaaatggga cggtctcaac cgtacccaaa gctgttttgg actcctggac
     7441 tcctacgttc aatacgcata ggcagcctct cttcgcccat ttgcgtaggc gaggggagtc
     7501 acaaatttag tgaaaagagt gattaggttt tctt
//