Typing tool

Complete norovirus genomes

JX459907  GII.4 Sydney
 GII.P31

Length: 7,560 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       JX459907                7560 bp    RNA     linear   VRL 10-MAY-2013
DEFINITION  Norovirus Hu/GII.4/Woonona/NSW3309/2012/AU, complete genome.
ACCESSION   JX459907
VERSION     JX459907.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Woonona/NSW3309/2012/AU
  ORGANISM  Norovirus Hu/GII.4/Woonona/NSW3309/2012/AU
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7560)
  AUTHORS   Eden,J.S., Tanaka,M.M., Boni,M.F., Rawlinson,W.D. and White,P.A.
  TITLE     Recombination within the Pandemic Norovirus GII.4 Lineage
  JOURNAL   J. Virol. 87 (11), 6270-6282 (2013)
   PUBMED   23536665
REFERENCE   2  (bases 1 to 7560)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2012) School of Biotechnology and Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
FEATURES             Location/Qualifiers
     source          1..7560
                     /organism="Norovirus Hu/GII.4/Woonona/NSW3309/2012/AU"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Woonona/NSW3309/2012/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:1241974"
                     /country="Australia"
                     /collection_date="May-2012"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AFV08791.1"
                     /translation="MKMASNDASAAAVANNNNDIAKSSSDGVFSNMAVTFKRALGARP
                     KQPPPKEIPPRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKGGVSGLPELTTVRQPE
                     ETNTAFSVPPLNQRESRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKILAFRQLAAENKYGLMDTMRVGKQLKDVKTM
                     PDLKQALKNIAIKKCQIVYNGSTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLR
                     CARIRYYVKCAQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEEMANKDGC
                     LKPKDDEEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIRDERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFVTSTHVIPQGAKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPNVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRDVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFQISISEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPFETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AFV08792.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIVVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPVLTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLASQNWNNYDPTDEIPAPLGTPDFVGKIQGML
                     TQTTRTDGSTRGHKATVYTGSADFAPKLGRVQFETDTDHDFEANQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRVV"
     CDS             6707..7513
                     /note="minor structural protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AFV08793.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGTINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFFETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGVLPGRANLRDAVPARGSSSKSS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQSRNLSPFMKGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
     3'UTR           7514..7560
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gttgccaaca acaacaacga
       61 catcgcaaaa tcttcaagtg acggtgtgtt ttctaacatg gctgtcactt ttaaacgggc
      121 cctcggggcg cggcctaaac agccgccccc gaaggaaata ccacccagac ccccgcgacc
      181 acccacacca gaattggtca aaaagatccc tcctccccca cccaacgggg aggatgaact
      241 agtggtctcc tatagcgcca aaggtggcgt ttccggactg cctgagctca ccactgtcag
      301 acaaccggaa gaaaccaaca cggcgttcag tgtcccccca ctcaaccaaa gggaaagcag
      361 ggacgccaag gagccactaa ctggaacaat tattgaaatg tgggatggag aaatctacca
      421 ttacggcctg tacgtggaac gaggtcttat acttggtgtg cacaagccac cggcagccat
      481 cagccttgcc aaggtcgagc taacaccgct ctctttgttc tggagacctg tatacacccc
      541 ccagtatctc atctctccag acactcttag gagactacat ggagagtcat tcccctatac
      601 tgcatttgac aacaattgct acgccttttg ttgttgggta ctagacctaa acgactcatg
      661 gctaagcagg agaatgattc agagaacaac aggtttcttc aggccgtacc aggattggaa
      721 caggaaaccc ctccccacta tggatgattc caaattaaag aaggtagcca acatattctt
      781 gtgcactttg tcttcactat tcaccagacc cattaaggac ataataggga agttgaaacc
      841 tcttaacatc cttaacattc tggctacatg tgattggacc ttcgcaggca tagtggaatc
      901 cttaatactc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttgctaggtg attatgaact gcaaggacct gaggaccttg cagtggaact
     1021 ggtcccaata gtgatggggg ggataggttt ggtgctagga tttaccaaag agaaaattgg
     1081 aaaaatgcta tcatccgctg catccacttt aagagcttgt aaagaccttg gtgcatacgg
     1141 actggaaatc ttaaaactgg tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 actggctatg gtgaggtcca tcgaggatgc agtgctagac ctcgaggcaa ttgaaaacaa
     1261 ccacatgacc accctactca aagacaaaga cagcttggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcca gaaaactctc aaccaaatct gcttcacccg acattgtggg
     1381 cacaatcaac tctcttctgg caagaatcgc tgctgcacgt tccctagtgc atcgggcgaa
     1441 agaagagctc tccagcaggc cgagacctgt cgttgtgatg atatcgggaa aaccagggat
     1501 agggaaaact caccttgcca gggagctggc caagaagatc gcggcctccc tcacagggga
     1561 ccagcgtgtg ggtcttatcc cgcgcaatgg tgtcgaccac tgggacgcat acaagggtga
     1621 aagagttgtc ctatgggacg attatggaat gagcaacccc atccatgatg ccctcaggtt
     1681 gcaggagctt gctgacactt gccccctcac gctaaattgt gatagaattg agaacaaagg
     1741 gaaagtcttt gacagtgatg ccataattat caccaccaat ctggccaacc cagcaccact
     1801 ggattatgtc aactttgaag cgtgctcgag acgcattgat ttcctcgtgt acgcagaagc
     1861 ccctgaggtg gagaaggcaa agcgcgactt cccaggtcaa cctgacatgt ggaagaacgc
     1921 tttcagccct gacttctcac acataaaact gtcattggct ccacagggtg gttttgacaa
     1981 gaacggcaac accccgcatg gaaaaggggt catgaagacc ctcaccaccg gctccctcat
     2041 cgcccgagca tcagggttac tccatgagag gctagatgaa tatgaactgc aaggcccagc
     2101 cctcaccact ttcaactttg accgcaacaa gatacttgct tttagacagc ttgctgctga
     2161 aaacaagtat gggctgatgg acacaatgag agttggaaaa cagctcaagg atgtcaagac
     2221 catgccagac ctcaaacaag cactcaagaa tatcgcgatc aagaagtgcc agatagtata
     2281 caatggtagc acctacacac ttgaggccga tggcaagggt agtgtgaaag ttgacaaagt
     2341 gcaaagcgcc actgtgcaga ccaacaatga actagccggt gccctacacc acctaaggtg
     2401 cgctagaatc agatactatg ttaagtgcgc ccaggaggca ctgtattcca tcatccaaat
     2461 cgctggggct gcattcgtca ccacgcgcat cgctaagcgc atgaatatac agaatctctg
     2521 gtccaagcca caggtggaag acacagaaga gatggccaac aaagatggtt gcctaaaacc
     2581 caaagatgat gaagagtttg tcgtctcatc cgacgacatc aaaactgagg gtaagaaagg
     2641 gaagaacaag tccggccgtg gcaagaagca cacagccttt tcaagcaaag ggctcagtga
     2701 tgaggagtac gatgagtaca agagaatcag agacgaaagg aatggtaagt attccataga
     2761 agagtacctt caggacagag acaggtacta cgaggaggtg gccattgcca gggcaaccga
     2821 agaggacttc tgtgaagaag aagaggccaa aatccggcag aggattttca gaccaacaag
     2881 gaaacaacgc aaagaagaga gggcctctct cggtttggtc acaggctctg aaatcaggaa
     2941 gagaaaccca gaagatttca aacccaaggg aaagctgtgg gctgatgatg acagaagtgt
     3001 tgactacaat gagaaactca actttgaggc cccaccaagc atctggtcgc ggatagtcaa
     3061 ctttggttca ggttggggct tctgggtctc ccccagtctg tttgtaacat caacccatgt
     3121 cataccccaa ggagcaaaag agttcttcgg agtccctatc aagcaaatcc agatacacaa
     3181 atcaggtgag ttctgccgat tgagattccc aaaaccaatc agaactgatg tgacgggcat
     3241 gatcctagaa gaaggtgcgc ccgaagggac cgtggccaca ctgctcatca agagaccaac
     3301 tggagagctc atgcctctgg cagccagaat ggggacccat gcaaccatga aaattcaggg
     3361 gcgcacagtt ggagggcaaa tgggtatgct cctgacagga tccaacgcca agagtatgga
     3421 cctaggcaca acaccaggcg actgcggctg cccctacatc tacaagaggg ggaatgacta
     3481 cgtggtcata ggagtccata cggccgctgc ccgtggagga aacactgtca tatgtgccac
     3541 ccaggggagt gagggagaag ccacacttga aggaggtgat agtaaaggga catactgtgg
     3601 tgcaccaatc ttgggcccag ggagcgctcc gaagctcagt accaagacta agttttggag
     3661 atcatccacc acaccactcc cacctggcac ctacgaacca gcctacctcg gtggcaaaga
     3721 ccccagagtc aaaggtggcc cttcattgca acaagttatg agggaccagc taaagccatt
     3781 cacagaaccc agaggcaaac caccaagacc aaacgtgttg gaagccgcca agaaaaccat
     3841 catcaatgtc cttgagcaaa caattgatcc accccaaaaa tggtcattcg cgcaagcttg
     3901 cgcatccctt gacaaaacca cctccagcgg ccacccacac cacatgcgga aaaacgattg
     3961 ttggaatggg gagtccttca caggaaaatt ggctgatcag gcctccaagg ccaacctaat
     4021 gtttgaagag ggaaagaaca tgactccagt ctacacaggt gcacttaaag atgagttggt
     4081 aaagaccgat aaagtttatg gtaagatcaa gaagaggctt ctgtggggtt cagatctggc
     4141 gaccatgata cggtgcgccc gagcttttgg aggccttatg gatgaactca aggcacactg
     4201 tgtcacactt cctgtcagag ttggtatgaa catgaatgag gatggcccca tcatctttga
     4261 gaagcactcc agatatagat atcactatga tgctgattat tcccggtggg actcaacaca
     4321 acaaagggat gtgctagcag cagcactaga aatcatggtt aagttctctc cagaaccaca
     4381 tctggcccag atagttgcag aagacctcct ttcccctagc gtgatggatg taggtgactt
     4441 ccaaatatca ataagtgagg gtctcccctc tggggtacct tgtacctccc agtggaattc
     4501 catcgcccac tggctcctca ccctttgtgc actctctgaa gtcacggacc tgtcccctga
     4561 catcattcag gccaactccc ttttctcctt ctatggtgat gatgagattg taagcacaga
     4621 cataaagttg gacccagaga agctgacagc aaaactcaag gagtacgggc ttaaaccaac
     4681 ccgccccgac aaaactgaag gaccccttgt catctctgaa gacctggatg gcctgacatt
     4741 cctccggaga actgtgaccc gtgatccagc tggctggttt ggaaaattgg aacaaagttc
     4801 aattctcagg caaatgtact ggaccagggg tcccaaccat gaagatccat ttgaaacaat
     4861 gataccacac tcccaaagac ccatacaatt gatgtccttg ctgggcgagg ctgcactcca
     4921 cggcccggca ttttatagca aaattagcaa gttagtcatt gcagagttga aggaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aataatgagg
     5161 ttatggctct ggagcccgtt gttggtgccg ccattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaacaatt ttgtacaagc ccctggtgga gagttcacag
     5281 tgtcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggt cctgatctaa
     5341 atccctacct atcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaattct cgcggggaac gcgttcaccg ccgggaaggt catatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ttaagcccca gccaggtcac tatgttcccc catatagtag
     5521 tagatgttag acaactagaa cctgtgctga ttcccttacc cgatgtcagg aataacttct
     5581 atcattacaa tcaatcaaat gactccacta ttaagttgat agcaatgttg tatacaccac
     5641 ttagggctaa taatgctggg gacgatgtct tcacagtttc ttgccgagtt ctcacgagac
     5701 catcccccga ttttgatttc atatttttag tgccacccac agttgagtca agaactaaac
     5761 cattctctgt cccagtttta actgttgagg agatgaccaa ttcaagattc cccattcctc
     5821 tggaaaagtt gttcacgggc cccagcagtg cctttgttgt tcaaccacaa aacggcaggt
     5881 gcacgactga tggcgtgctc ctaggcacca cccaactgtc tcctgtcaat atctgcacct
     5941 tcagagggga tgtcacccac atcacaggta gtcgtaacta cacaatgaat ttggcttctc
     6001 aaaattggaa caattatgac ccaacagacg aaatcccagc ccctctaggg actccagatt
     6061 ttgtggggaa gattcaaggc atgctcaccc aaaccacaag gacagatggc tcgacacgcg
     6121 gccacaaagc tacagtgtac actgggagcg ccgactttgc tccaaaactg ggtagagttc
     6181 aatttgaaac tgacacagac catgattttg aagctaacca aaacacaaag ttcaccccag
     6241 tcggtgttat ccaagatggt agcaccaccc accgaaatga accccaacag tgggtgctcc
     6301 caagttactc aggcagaaat actcataatg tgcatctggc ccccgctgta gcccccactt
     6361 ttccgggtga gcaacttctc ttcttcagat ccaccatgcc cggatgcagc gggtacccca
     6421 acatggattt ggactgtctg ctcccccagg aatgggtgca gtacttctac caagaagcag
     6481 ccccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg taagcttcat aaatcaggct atgttacagt ggctcacact ggccaacatg
     6601 atttggttat cccccccaat ggttatttta ggtttgattc ctgggtcaac cagttctaca
     6661 cgcttgcccc catgggaaat ggaacggggc gtagacgtgt agtataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctggactt ggttccctta tcaatgctgg
     6781 ggctgggacc atcaaccaaa aagttgagtt tgaaaataac agaaaattgc aacaagcatc
     6841 cttccaattt agcagcaatc tacaacaggc ttcctttcaa catgacaaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagctaca acaggaaatg atgaaagtta agcaggcaat
     6961 gctcctagag ggtgggttct ttgagacaga tgcagcccgc ggggcaatca acgcccccat
     7021 gacaaaagct ttggactgga gcgggacaag gtactgggct cccgatgcta ggactacaac
     7081 atacaatgca ggccgctttt ccaccccaca accatcgggg gtactgccag gaagagctaa
     7141 tcttagggat gctgtccctg ctcggggttc ctccagcaaa tcttctaact cttctactgc
     7201 tacttctgtg tactcaaatc aaactacttc aacgagactt ggttctacag ctggttctgg
     7261 aaccagtgtc tcgagcctcc cgtcaactgc aaggactagg agctgggttg aggatcaaag
     7321 taggaatttg tcacctttca tgaagggggc ccacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgcct aaagagattt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt ctttttcttt agtgtctttt
//