Typing tool

Complete norovirus genomes

JX459906  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,560 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       JX459906                7560 bp    RNA     linear   VRL 10-MAY-2013
DEFINITION  Norovirus Hu/GII.4/Miranda/NSW850K/2011/AU, complete genome.
ACCESSION   JX459906
VERSION     JX459906.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Miranda/NSW850K/2011/AU
  ORGANISM  Norovirus Hu/GII.4/Miranda/NSW850K/2011/AU
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7560)
  AUTHORS   Eden,J.S., Tanaka,M.M., Boni,M.F., Rawlinson,W.D. and White,P.A.
  TITLE     Recombination within the Pandemic Norovirus GII.4 Lineage
  JOURNAL   J. Virol. 87 (11), 6270-6282 (2013)
   PUBMED   23536665
REFERENCE   2  (bases 1 to 7560)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2012) School of Biotechnology and Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
FEATURES             Location/Qualifiers
     source          1..7560
                     /organism="Norovirus Hu/GII.4/Miranda/NSW850K/2011/AU"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Miranda/NSW850K/2011/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:1241970"
                     /country="Australia"
                     /collection_date="Jun-2011"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AFV08788.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSNMAVTLKRALGARP
                     KQPPPREIPQGPPRPTTPELVKKIPPPPPNGEDEVVVSYSAKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGR
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEESTNKDGC
                     PKPKDNEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYNKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AFV08789.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFGTDTENDFETHQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRDVPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="minor structural protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AFV08790.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAVLLEGGFFETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGVLPGRANPRTPTPARGSPNTSS
                     NASTATSIYSNQTVSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAYNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
     3'UTR           7514..7560
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acaaaatgtt ttctaacatg gctgtcactc tcaaacgagc
      121 cctcggggcg cggcctaaac agcccccccc gagggaaata ccacaaggac ccccacgacc
      181 aactactcca gaactggtca aaaagatccc tccccccccg cccaacggag aggacgaagt
      241 agtggtttct tatagtgcca aagatggtgt ctccggtttg cctgagcttt ccaccgtcag
      301 gcaaccggaa gaaaccaata cggctttcag tgtccctccc ctcaatcaga gggagaatag
      361 ggatgctaag gaaccactga ctggaacaat tctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgttgagc gaggtcttgt gctgggtgtg cacaaaccac cagctgccat
      481 tagcctcgcc aaggtcgaac taacaccact ctccttgttc tggagacctg tgtacactcc
      541 tcagtacctc atctctccag acacactcaa gaaattacac ggagaaacat ttccctacac
      601 agccttcgac aacaattgct atgccttctg ttgctgggtc ctggatctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgattc caaattaaag aaggtagcta acatattcct
      781 gtgcaccctg tcttcgctat tcaccaggcc cataaaagac ataataggga ggttaaggcc
      841 tctcaacatc atcaacatcc tggcttcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ttggcagagc tctttggagt cttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg atttcgagtt acaagggcct gaggaccttg tagtggagct
     1021 cgttcctgta gtaatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catctacctt aagagcttgt aaagatcttg gtgcgtatgg
     1141 gctagagatc ctaaagttag tcatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtgctagac cttgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagcctggca acctatatga gaacccttga
     1321 cctcgaggaa gagaaagcca gaaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc cgctgcacgc tccctggtgc accgagcgaa
     1441 ggaggagctt tctagcagac caagacctgt agtcttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc tcacaggaga
     1561 ccagcgcgta ggcctcatcc cacgcaatgg cgtcgaccac tgggatgcgt acaaggggga
     1621 gagggtcgtc ttatgggacg actatggaat gagcaatccc attcacgacg ccctcaggct
     1681 gcaagaactc gctgacactt gccccctcac actaaactgt gacaggattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcatcattat cactactaac ctggccaacc cagcaccact
     1801 ggactatgtc aactttgaag cgtgctcgag gcgcattgat ttcctcgtgt atgcagaagc
     1861 ccccgaggtc gaaaaggcga agcgtgactt cccaggccaa cctgacatgt ggaaaaacgc
     1921 ttttagtcct gatttctcac acataaaatt ggcactggct ccacaaggtg gctttgataa
     1981 gaacgggaac accccacatg ggaagggcgt catgaagact ctcaccactg gctccctcat
     2041 tgcccgggca tcagggctgc tccatgagag attggatgag tttgaactac agggcccagc
     2101 tcttaccacc ttcaactttg accgcaacaa agtgcttgcc ttcaggcagc ttgctgctga
     2161 aaataaatac gggttgatgg acacaatgaa agttgggagg cagctcaagg atgtcaaaac
     2221 catgccagaa cttaaacaag cactcaagaa tatctcaatc aagaagtgcc agattgtgta
     2281 tagtggttgc acctacacac ttgagtctga tggcaagggc aatgtgaaag ttgatagagt
     2341 tcagagcacc tccgttcaga ccaacaatga gctggctggc gccctgcacc acctgaggtg
     2401 cgccagaatc aggtactatg tcaagtgtgt tcaggaggcc ctgtattcta tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat catcaagcgt gtgaacattc aagacttatg
     2521 gtccaagcca caagtggaaa acacagagga gtccaccaac aaggacgggt gcccgaaacc
     2581 caaagataat gaggagttcg tcatttcatc tgacgacatt aaaactgagg gtaagaaagg
     2641 gaagaacaag actggccgtg gcaagaagca cacagccttc tcaagtaaag gtctcagtga
     2701 tgaagagtat gatgagtaca agagaattag agaggaaagg aatggtaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaagaggtg gccattgcca gggcgaccga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttca gaccaacaag
     2881 gaaacaacgc aaggaagaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 aaggaaccca gacgacttca agcctaaggg gaaactatgg gctgacgatg acagaagtgt
     3001 ggactacaat gaaaaactca gttttgaggc cccaccaagt atctggtcaa ggatagtcaa
     3061 ctttggctca ggttggggct tctgggtctc ccccagcctg tttataacat caacccacgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaattc aggtacacaa
     3181 gtcaggcgag ttctgtcgct tgaggttccc aaaaccaatc aggactgatg tgactggcat
     3241 gatcctggaa gaaggcgcgc ccgaaggcac cgtggtcaca ctactcatca aaaggtctac
     3301 tggagaactc atgcccttag cagctagaat ggggacccat gcaaccatga aaattcaagg
     3361 gcgcactgtt ggaggtcaga tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 tctaggcacc acaccaggtg attgcggctg tccctacatc tacaagagag gaaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 ccaggggggt gagggggaag ctacacttga aggtggtgac aataagggaa catactgtgg
     3601 cgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaaaacca aattctggag
     3661 atcatccaca gcaccactcc cacctggcac ctatgaacca gcctaccttg gcggcaagga
     3721 ccccagagtc aagggtggcc cctcgttgca gcaagttatg agggaccagc tgaaaccatt
     3781 tacagagcct aggggtaagc caccaaaacc aagtgtgtta gaggctgcca agaaaaccat
     3841 catcaatgtc cttgaacaaa caattgaccc acctgagaag tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttctagcgg ccatccacac cacatgcgga aaaacgactg
     3961 ctggaacggg gaatctttca caggcaagct ggcggaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgactccagt ctacacaggt gcacttaagg atgaattagt
     4081 caaaactgac aaaatttatg gtaagatcaa gaagaggtta ctctggggct cggatttggc
     4141 aaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcacactg
     4201 tgtcacactc cctatcagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaagcattcc aggtacagat accactatga tgctgattac tctcggtggg attcaacaca
     4321 acagagagcc gtgctggcag ctgctctaga aatcatggtt aaattctcct cagaaccaca
     4381 tttggctcag gtagtagcag aagaccttct ttctcccagc gtggtggacg tgggggactt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgcct tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc actctctgaa gttacaaatt tgtccccaga
     4561 catcatacag gctaattctc tcttctcctt ctatggtgat gatgaaattg ttagtacaga
     4621 cataaaatta gacccagaga agttgacagc aaagcttaag gaatacgggt tgaaaccaac
     4681 ccgccctgat aaaactgaag gacctcttgt tatttctgaa gacttagatg gcttgacctt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagctc
     4801 aatactcagg caaatgtact ggactagggg ccctaaccat gaagatccat ctgaatcaat
     4861 gattccacac tctcaaagac ccatacaatt gatgtcctta ctgggagagg ccgcactcca
     4921 cggcccaaca ttctacaata aaatcagcaa attagtcatt gcagagttaa aagaaggtgg
     4981 tatggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gtcggtgccg ctattgcggc gcctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagttcacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc tcccttaggc cctgatctga
     5341 atccctacct atctcatttg gccagaatgt ataatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccggaaaaat tatatttgca gcagtcccac
     5461 caaatttccc gactgaaggc ttgagtccca gccaggtcac tatgttcccc cacataatag
     5521 tggatgttag gcaattggaa cctgtgttga tccccttacc tgatgttagg aataacttct
     5581 atcattataa tcaatcaaat gattctacca ttaaattgat agcaatgctg tatacaccac
     5641 ttagggctaa taatgctggg gaagatgtct tcacagtctc ttgtcgagtc ctcacgaggc
     5701 catcccctga ttttgatttt atatttttgg tgccacctac agttgagtca agaactaaac
     5761 catttactgt cccaatcttg actgttgagg aaatgaccaa ttcaagattc cccattcctt
     5821 tggaaaagtt gttcacgggt cccagcagtg cctttgttgt tcaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ttaggcacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac attgcaggtt ctcgtaatta cacaatgaat ttggcttctc
     6001 taaattggaa caattatgac ccaacagaag aaattccagc ccctctagga actccagatt
     6061 tcgtgggaaa gattcaaggt gtgctcactc aaaccacaaa gggagatggt tcgacccgtg
     6121 gtcataaagc tacagtttac actgggagtg cccccttcac tccaaagctg ggcagtgttc
     6181 aattcggtac tgatacagaa aatgattttg aaactcacca aaacacaaaa ttcaccccag
     6241 tcggtgtcat ccaggatggt ggcaccaccc accgaaatga accccaacaa tgggtgctcc
     6301 caagttattc aggtagagat gtccctaatg tacacctagc ccctgctgta gcccccactt
     6361 tcccgggtga acaacttctt ttctttaggt ctactatgcc cggatgcagc gggtatccca
     6421 acatggattt ggattgccta ctcccccagg agtgggtgca gcacttctac caagaggcag
     6481 ctccagcaca atctgatgtg gctctattga gatttgtgaa tccagacacg ggcagggttc
     6541 tgtttgagtg caaacttcat aaatcaggct atgtcacagt ggctcacacc ggccagcatg
     6601 atttggtcat cccccccaat ggttatttta ggtttgattc ctgggttaat caattctaca
     6661 cacttgcccc catgggaaat ggaacggggc gtagacgtgc tttataatgg ctggagcttt
     6721 ctttgctggg ttggcatctg atgttcttag ctctggactt ggttccctaa tcaatgctgg
     6781 ggctggggct atcaaccaaa agattgattt tgaaaacaac agaaaattgc agcaagcttc
     6841 cttccagttt agcagtaatc tacaacaggc ttcctttcaa catgataaag aaatgctcca
     6901 agcacaaatt gaggccacca aaaagttgca acaggaaatg atgaaagtca aacaggcagt
     6961 gctcttagaa ggtggattct ttgaaacaga tgcagcccgt ggggcaatca acgcccctat
     7021 gacaaaggct ctggactgga gcggaacaag gtactgggcc cctgatgcta ggactacaac
     7081 atacaacgca ggccgttttt ccacccctca accttcgggg gtactgccag gaagagccaa
     7141 tcccaggact cctacccccg ctcggggctc ccccaacaca tcttctaatg cttctactgc
     7201 tacttctata tattcaaatc aaactgtttc aacgagactt ggttctacag ctggttctgg
     7261 caccagtgtc tcgagtctcc cgtcaactgc aaggactagg agttgggttg aggatcaaaa
     7321 cagaaatttg tcacctttca tgaggggggc ttacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tccagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta ggcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt ccctttcttt agtgtctttt
//