Typing tool

Complete norovirus genomes

JX459905  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,560 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       JX459905                7560 bp    RNA     linear   VRL 10-MAY-2013
DEFINITION  Norovirus Hu/GII.4/Randwick/NSW938K/2011/AU, complete genome.
ACCESSION   JX459905
VERSION     JX459905.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Randwick/NSW938K/2011/AU
  ORGANISM  Norovirus Hu/GII.4/Randwick/NSW938K/2011/AU
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7560)
  AUTHORS   Eden,J.S., Tanaka,M.M., Boni,M.F., Rawlinson,W.D. and White,P.A.
  TITLE     Recombination within the Pandemic Norovirus GII.4 Lineage
  JOURNAL   J. Virol. 87 (11), 6270-6282 (2013)
   PUBMED   23536665
REFERENCE   2  (bases 1 to 7560)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2012) School of Biotechnology and Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
FEATURES             Location/Qualifiers
     source          1..7560
                     /organism="Norovirus Hu/GII.4/Randwick/NSW938K/2011/AU"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Randwick/NSW938K/2011/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:1241972"
                     /country="Australia"
                     /collection_date="Aug-2011"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AFV08785.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEVVVSYSAKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVEQGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTFTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQMENTEEATNKDGC
                     PKPKDIEEFVISSDDIKTEGKKGKNKAGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGASKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKDGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMAPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPFESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AFV08786.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPSYSGRNVPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="minor structural protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AFV08787.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFFETDAARGAIN
                     APMTKVLDWSGTRYWAPDARTTTYNAGRFSSPQPSGALLGRINPRIPTPARGSSSTSS
                     NASTATSIYSNQTVSTRLGSTAGSGTNVSSLPSTARTRSWVEDQNRNLSPFMRGAHNV
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIHRRGESRV"
     3'UTR           7514..7560
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acaaaatgtt ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcccccccc gagggaaata ccacaaagac ccccgcgacc
      181 acctactcca gaactggtca aaaagatccc tcctccccca cccaacgggg aggatgaagt
      241 agtggtttct tatagtgcca aagatggcgt ttccggttta cctgagcttt ccaccgtcag
      301 gcaaccggag gaaaccaata cggccttcag tgtccctcca ctcaatcaga gggagaatag
      361 ggatgctaag gaaccactga ctggaacaat tctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgttgagc aaggtcttgt gttgggtgtg cacaaaccac cagctgccat
      481 cagtctcgcc aaggtcgaac taacaccact ctccttgttc tggagacctg tgtacactcc
      541 tcaatacctc atctctccag acactctcaa gaaattacac ggagaaacat tcccctacac
      601 agccttcgac aacaactgct atgccttttg ttgctgggtc ctggatctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagactggaa
      721 taggaaaccc ctccccacta tggatgattc caaattaaag aaggtggcta atatattcct
      781 gtgcaccctg tcttcgctat tcactaggcc cataaaagac ataataggga agctaaggcc
      841 tctcaacatc atcaacatct tggcttcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ttggcagagc tctttggagt cttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg atttcgagtt acaaggacct gaggaccttg tagtggagct
     1021 cgtccctgta gtaatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catctacctt gagagcttgt aaagatcttg gtgcgtatgg
     1141 gctagagatc ctaaagttag tcatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtgctggac ctcgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagcctggca acctatatga gaacccttga
     1321 cctcgaggaa gagaaagcca gaaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc cgctgcacgc tccctggtgc accgggcgaa
     1441 ggaggagctt tccagcagac caagacctgt agtcttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatt gcagcctccc tcacaggaga
     1561 ccagcgtgtg ggtctcatcc cacgcaatgg cgtcgatcac tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagcaatccc atccacgacg ccctcaggct
     1681 gcaagaactc gctgacactt gccccctcac tctaaattgt gacagaattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcattatcat cactactaac ctggccaacc cagcaccact
     1801 ggactatgtc aactttgaag cgtgctcgag gcgcatcgat ttcctcgtgt atgcagaagc
     1861 ccccgaggtc gaaaaggcga agcgtgactt cccgggccaa cctgacatgt ggaaaaacgc
     1921 ttttagttct gatttctcac acataaaatt ggcactggct ccacagggtg gctttgataa
     1981 gaacgggaat accccacacg ggaagggcgt catgaagact ctcaccactg gctccctcat
     2041 tgcccgggca tcagggctgc tccatgagag attggatgag tttgaactac agggcccagc
     2101 tcttaccacc ttcaactttg accgcaacaa agtgcttgcc ttcaggcagc ttgctgctga
     2161 aaacaaatac ggtttgatgg acacaatgaa agttgggagg cagctcaagg atgtcaaaac
     2221 catgccagaa ctcaaacaag cactcaagaa tatctcaatc aagaagtgcc agattgtgta
     2281 tagtggttgc actttcacac ttgagtctga tggtaagggc aatgtgaaag ttgacagagt
     2341 tcagagcacc tccgttcaga ccaacaatga gctggctggc gccctgcacc atctaaggtg
     2401 cgccagaatc aggtactatg tcaagtgtgt tcaggaggcc ctgtattcta tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat catcaagcgt gtgaacattc aagatttatg
     2521 gtccaagcca caaatggaaa acacagagga ggccaccaac aaggacgggt gtccaaaacc
     2581 caaagacatt gaagagttcg tcatttcatc tgacgacatt aaaactgaag gtaagaaagg
     2641 gaagaacaag gccggccgtg gcaagaagca cacagccttc tcaagtaaag gtctcagcga
     2701 tgaagagtat gatgagtaca agagaattag agaggaaagg aatggcaagt actccataga
     2761 agagtaccta caggataggg acaaatacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttca ggccaacaag
     2881 gaaacaacgc aaggaagaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 aaggaaccca gaagacttca agcctaaagg gaaactatgg gctgacgatg acagaagtgt
     3001 ggactacaat gaaaaactca gctttgaggc cccaccaagc atctggtcaa ggatagtcaa
     3061 ctttggttca ggttggggct tctgggtttc ccccagcctg ttcataacat caacccacgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaatcc aggtgcacaa
     3181 gtcaggcgaa ttctgtcgct tgaggttccc aaaaccaatc aggactgatg tgactggcat
     3241 gatcttagaa gaaggtgcgc ccgaaggcac cgtggttaca ctactcatca aaaggtccac
     3301 tggagaactc atgcccctag cagctagaat ggggacccat gcaaccatga agattcaagg
     3361 gcgcactgtt ggaggacaga tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 tctaggcacc acaccaggtg attgcggctg tccctatatc tacaagagag gaaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 ccaggggggt gagggggaag ccacacttga aggtggtgcc agtaagggaa catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaaaacca aattctggag
     3661 atcatccaca gcaccactcc cacctggcac ctatgaacca gcctacctag gtggcaagga
     3721 ccccagggtc aaggacggcc cctcgttgca gcaagtcatg agggaccagc tgaaaccatt
     3781 tacagagcct aggggtaagc caccaaagcc aagcgtgtta gaagctgcca agaaaaccat
     3841 catcaatgtc cttgaacaaa caattgaccc acctgagaag tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttctagcgg ccatccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gaatccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa ggaaagaaca tggccccagt ctacacagct gcacttaagg atgaattagt
     4081 taagactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct cggatttagc
     4141 aaccatgatc cggtgtgctc gagcattcgg aggcctgatg gatgaactca aagcacactg
     4201 tgtcacactt cctatcagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaagcattcc aggtacagat accactatga tgctgactac tctcggtggg attcaacaca
     4321 acagagagct gtgctggcag ctgctttaga aatcatggtt aaattctcct cagaaccaca
     4381 tttggctcag gtagtagcgg aagaccttct ttctcctagc gtggtggatg tgggtgactt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggctcctca ctctctgtgc actctccgaa gtcacaaatt tgtccccaga
     4561 catcatacag gctaattctc tcttctcctt ctatggtgat gatgaaattg ttagcacaga
     4621 cataaaatta gacccagaga agttgacagc aaagcttaag gaatacgggt tgaaaccaac
     4681 tcgccctgat aaaactgaag gacctcttgt tatttctgaa gacttagatg gtttgacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagctc
     4801 aatactcagg caaatgtact ggactagggg ccccaaccat gaagacccat ttgaatcaat
     4861 gattccacac tctcaaagac ccatacaatt gatgtccttg ctgggagagg ccgcgctcca
     4921 cggcccaacg ttctacagta aaatcagcaa attagtcatt gcagagctaa aagaaggtgg
     4981 tatggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcagacct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gtcggtgccg ctattgcggc gcccgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagttcacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagtgc gcccttaggc cctgatctga
     5341 atccctacct atctcacttg gccagaatgt ataatggtta tgcaggtggt tttgaagtgc
     5401 aggtgatcct cgcggggaac gcgttcaccg ccggaaaaat tatatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ttgagtccca gccaggtcac tatgttcccc cacataatag
     5521 tggatgttag gcaattggaa cctgtgttga tccccctacc tgatgttagg aataacttct
     5581 atcactataa ccagtcaaat gattctacca ttaaattgat agcaatgctg tatacaccac
     5641 ttagggctaa taatgctggg gaagatgtct ttacagtctc ttgtcgagtt ctcacgaggc
     5701 catcccctga ttttgatttt atattcttag tgccacctac agttgagtca agaactaaac
     5761 catttactgt cccaatctta actgttgaag aaatgaccaa ttcaagattc cccattcctt
     5821 tggaaaaatt gttcacgggt cccagcagtg cctttgttgt ccaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ttaggcacca cccaactgtc tcctgtcaac atttgcacct
     5941 tcagagggga tgtcacccac attgcaggtt ctcgcaatta cacaatgaat ttggcctctc
     6001 taaattggaa caattatgac ccaacagaag aaatcccagc ccctctaggg actccagact
     6061 tcgtgggaaa gattcaaggt gtgctcactc aaaccacgaa gggagatggc tcgacccgtg
     6121 gccataaagc tacagtttac actgggagtg ccccctttac tccaaagctg ggtagtgttc
     6181 aatttagtac tgatacagag aatgattttg aaactcacca aaatacaaaa ttcaccccag
     6241 tcggtgtcat ccaggatggt ggcaccaccc accgaaatga accccaacaa tgggtgctcc
     6301 caagttattc aggtaggaat gtccctaatg tacacctagc ccctgctgta gcccccactt
     6361 ttccgggtga acaacttctt ttctttaggt ccactatgcc cggatgcagc gggtatccca
     6421 acatggattt ggattgccta ctcccccagg agtgggtgca gcacttctac caagaggcag
     6481 ctccagcaca atctgatgtg gctctattga gatttgtgaa tccagacacg ggtagggtcc
     6541 tgtttgagtg caagctccat aaatcaggct atgtcacagt ggctcacacc ggccagcatg
     6601 atttggtcat cccccccaat ggttatttta gatttgactc ctgggttaat caattctaca
     6661 cgcttgcccc catgggaaat ggaacggggc gtagacgcgc cttataatgg ctggagcttt
     6721 ctttgctgga ttggcgtctg atgtccttag ctctggactt ggttccctaa tcaatgctgg
     6781 ggctggggct atcaaccaaa agattgattt tgaaaataac agaaaattgc agcaagcctc
     6841 cttccagttt agcagtaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacta aaaagttgca acaggaaatg atgaaagtca aacaggcaat
     6961 gctcttagaa ggtggattct ttgaaacaga tgcagcccgt ggggcaatta acgcccctat
     7021 gacaaaggtc ttggactgga gcggaacaag gtactgggcc cctgatgcta ggactacaac
     7081 atacaatgca ggccgttttt cctcccctca accttcgggg gcactgctag gaagaatcaa
     7141 tcccaggatt cccacccccg ctcggggctc ctctagcaca tcttctaatg cttccactgc
     7201 tacttctata tattcaaatc aaactgtttc aacgagactt ggttctacag ctggttctgg
     7261 caccaatgtc tcgagtctcc cgtcaactgc aaggactagg agttgggttg aggatcaaaa
     7321 cagaaatttg tcacctttca tgaggggggc tcacaacgta tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgcc cacattcata ggcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt ccctttcttt agtgtctttt
//