Typing tool

Complete norovirus genomes

JX459903  GII.4 New Orleans
 GII.P4 Hunter

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       JX459903                7559 bp    RNA     linear   VRL 10-MAY-2013
DEFINITION  Norovirus Hu/GII.4/Jannali/NSW774M/2011/AU, complete genome.
ACCESSION   JX459903
VERSION     JX459903.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Jannali/NSW774M/2011/AU
  ORGANISM  Norovirus Hu/GII.4/Jannali/NSW774M/2011/AU
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7559)
  AUTHORS   Eden,J.S., Tanaka,M.M., Boni,M.F., Rawlinson,W.D. and White,P.A.
  TITLE     Recombination within the Pandemic Norovirus GII.4 Lineage
  JOURNAL   J. Virol. 87 (11), 6270-6282 (2013)
   PUBMED   23536665
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2012) School of Biotechnology and Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus Hu/GII.4/Jannali/NSW774M/2011/AU"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Jannali/NSW774M/2011/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:1241969"
                     /country="Australia"
                     /collection_date="Feb-2011"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AFV08779.1"
                     /translation="MKMASNDASAAAVADSNNDTVKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELIKNIPPPPPNGEDDIVVSYSVKGGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     FARVELTPLSLYWRPVYTPQYLISPDALKRLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTYLAREV
                     AKRIAASLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNISIKKCQIVYSGSTYTLESDGKGNVKVDRVQSASVQTNNELAGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQSLWSKPQVENTEETTSKDGC
                     PKPKEDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLAISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGS
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AFV08780.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLATQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRADGSTRGHKATVYTGSADFAPKLGRVQFATDTDHDFDANQNTKFTPVGVIQDG
                     DTAHRNEPQQWVLPSYSGRNSHNVHLAPTVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="minor structural protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AFV08781.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFFETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGHFSTPQPSGALPGRANLRAAVPARGSSNTPS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARARSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRA"
     3'UTR           7514..7559
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gttgctgata gcaacaacga
       61 caccgtaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt tcaaacgagc
      121 cctcggggcg cggcctaaac agcctccccc gagggaaata ccacaaagac ccccacgacc
      181 acccactcca gaactgatca aaaatatccc ccctccccca cccaacggag aggacgacat
      241 agtggtttct tatagtgtca aaggtggcgt ctctggtttg cctgatcttt ccaccgtcag
      301 gcaaccggaa gaatctaata cggccttcag tgtccctcca ctcaaccaga gggagaatag
      361 agatgctaag gaaccactga ctggaacaat tttggaaatg tgggatggag aaatctatca
      421 ttatggcctg tatgtagagc gaggtcttgt gctaggtgtg cacaaaccac cagctgccat
      481 cagcttcgct agggtcgaac taacaccact ttccttgtac tggagacctg tgtatactcc
      541 ccagtacctc atctctccag acgctctcaa gagactacac ggagagacgt tcccctacac
      601 agcttttgac aacaactgct acgccttttg ttgttgggtc ctggacctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgactc caagttaaag aaggtagcta acatattcct
      781 gtgtgcactg tcttcgctat tcaccaggcc tataaaagat ataataggga agctaaggcc
      841 tcttaacatc cttaacatct tggcctcatg tgattggact tttgcaggca tagtggagtc
      901 cttgatactc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg actacgagct acagggacct gaggaccttg cagtggagct
     1021 cgtccctgta gtgatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catccacctt gagagcttgt aaagatcttg gtgcatatgg
     1141 gctagagatc ctaaagttgg ttatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggccata gtgagatcca tcgaggatgc agtcctggat ctcgaagcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagtctggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcca ggaaactctc gaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc tgctgcacgc tctctggtgc atcgagcgaa
     1441 ggaggaactt tctagcagac caagacctgt agtgttgatg atatcaggca gaccaggaat
     1501 agggaagacc taccttgcca gggaagtggc taagagaatc gcagcctccc ttacaggaga
     1561 ccagcgtgta ggcctcgtcc cacgcaatgg cgtcgaccat tgggatgcgt acaaggggga
     1621 gagggtcgtt ctatgggacg actatggaat gagcaatcct atccacgatg ccctcagatt
     1681 gcaagaactc gctgacactt gtcccctcac cctaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagcgatg tcatcattat caccactaat ttggctaacc cagcaccact
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccctgaggtc gaaaaggcga agcgtgactt cccaggccaa cccgacatgt ggaagaacgc
     1921 cttcagttct gatttctcac acataaaact aacattggct ccacagggtg gtttcgacaa
     1981 gaacgggaac accccacacg ggaagggcgt catgaagact ctcaccaccg gctcccttat
     2041 tgcccgggca tcagggctac tccatgaaag actagatgaa tttgaactac agggcccaac
     2101 tctcaccact ttcaactttg atcgcaataa agtgcttgcc tttagacaac ttgctgctga
     2161 aaataaatat gggttgatgg acacaatgaa agttgggagg cagctcaagg atgtcagaac
     2221 aatgccagaa ctcaagcaag cactcaagaa tatttcaatc aagaagtgcc aaatagtgta
     2281 tagtggtagc acctatacac ttgagtctga tggcaagggt aatgtgaagg ttgacagagt
     2341 tcaaagcgcc tccgtgcaga ccaacaatga gctggctggc gccctacacc atctaaggtg
     2401 cgccagaata agatactatg tcaggtgtgt ccaggaggcc ctgtattcca tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aaagcctatg
     2521 gtctaagcca caagtggaaa atacagagga gactaccagc aaggacgggt gcccaaaacc
     2581 caaagaagat gaggagttcg tcatttcatc cgacgacatc aaaactgagg gcaagaaagg
     2641 gaaaaacaag actggccgcg gtaagaagca cacagccttc tcaagcaaag gtctcagtga
     2701 tgaagagtac gacgagtaca agaggattag agaagaaagg aatggtaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgactga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttca ggccaacaag
     2881 gaaacaacgc aaggaggaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 aagaaatcca gatgatttca aacccaaggg gaaactgtgg gctgacgatg acagaagtgt
     3001 ggactacaat gagaaactca gttttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggat tctgggtctc ccccagtttg ttcataacat caacccatgt
     3121 cataccccaa ggagcgaagg agttctttgg agtccccatc aaacaaattc aggtacataa
     3181 gtcaggcgaa ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcac ccgagggaac cgtggttaca ctactcatca aaagatccac
     3301 tggggagctc atgcccctgg cagctaggat ggggacccat gcaaccatga aaatccaagg
     3361 gcgcactgtt ggaggtcaaa tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 tctgggtacc acaccaggtg attgtggctg tccctacatc tacaagaggg gaaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtgggggc aacactgtca tatgtgccac
     3541 ccaggggagt gagggagagg ctacacttga aggtggtgac aataaaggga catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaagacca aattctggag
     3661 atcatccaca gcaccactcc cacctggcac ctatgaacca gcttatcttg gtggtaagga
     3721 tcccagagtc aagggtgggc cttcactaca gcaggtcatg agggatcagc taaagccatt
     3781 cacagagccc aggggcaagc caccaaagcc aagtgtgttg gaagctgcta agaaaaccat
     3841 catcaatgtc cttgagcaaa caattgatcc acctgagaaa tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacca cctccagtgg ccatccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgacgccagt ctacacagct gcgcttaagg atgagttagt
     4081 taaaactgac aaaatttatg gcaagatcaa gaagaggctt ctctggggct cggatttggc
     4141 gaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcgcactg
     4201 tgtcacactt cccattagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaggcactcc aggtacacgt accactatga tgctgattac tctcgatggg attcaacaca
     4321 acagagagcc gtgttggcag cagctctaga aatcatggtt aagttctccc cagaaccaca
     4381 tttggcccag gtagtcgcag aagaccttct ttctcctagc gtggtggatg tgggtgactt
     4441 cacaatatca attaacgagg gccttccttc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ccctctgtgc gctctctgaa gttacaaact tgtctcctga
     4561 caccatacaa gctaactccc tcttctcttt ttatggtgat gatgaaattg ttagcacaga
     4621 cataaaattg gacccagaaa agttgacagc aaagctcagg gaatatgggt taaaaccaac
     4681 ccgccccgac aagactgaag gaccccttgc catctctgaa gacttgaatg gcctgacttt
     4741 cttgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactag agcagagttc
     4801 aatactcagg caaatgtact ggactagggg ttccaaccat gaagacccat ctgaaacaat
     4861 gattccacat tcccaaagac ccatacaatt gatgtcccta ctgggggagg ccgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa gttagtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ccattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagttcacag
     5281 tatcccctag gaacgctcca ggtgaaatac tgtggagcgc gcccctaggc cctgatttga
     5341 atccttacct ttcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccggaaaaat catatttgca gcagtcccac
     5461 caaatttccc aactgaaggc ttgagcccca gccaggttac tatgttcccc cacataatag
     5521 tagatgttag gcaactggaa cctgtgttga tccccttacc cgatgttagg aataatttct
     5581 accattacaa tcaatcaaat gaccccacca tcaaattgat agcaatgttg tacacaccac
     5641 ttagggctaa taatgctggg gacgatgtct tcacagtttc ttgtcgggta ctcacgagac
     5701 catcccccga ttttgatttc atatttttag tgccacccac agttgaatca agaactaaac
     5761 cattctctgt cccaatttta actgttgagg agatgaccaa ttcaagattc cccattcctt
     5821 tggaaaagct gttcacgggt cccagcagtg cctttgttgt tcaaccacaa aacggcaggt
     5881 gcacgactga tggcgtgctc ctaggtacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccat attacaggta gtcgtaacta cacaatgaat ttggctactc
     6001 aaaattggaa cagttatgac ccaacagaag aaatcccagc ccctctagga actccagatt
     6061 tcgtgggaaa gatccaaggt gtgctcaccc aaaccacgag ggcagatggc tcgacccgtg
     6121 gacacaaggc tacagtgtac actgggagcg ccgactttgc tccaaaactg ggtagagttc
     6181 aatttgccac tgacacagac catgattttg atgctaacca aaacacaaag ttcaccccag
     6241 tcggtgtcat ccaggatggt gatactgccc accgaaatga accccaacaa tgggtgctcc
     6301 caagttactc aggtagaaat agtcacaatg tgcacctggc ccccactgta gcccccactt
     6361 ttccgggtga gcaacttctc ttctttagat ccactatgcc cggatgcagc gggtacccca
     6421 acatggattt ggactgtctg ctcccccagg aatgggtgca gtatttctat caagaggcag
     6481 ccccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg taagcttcat aaatcaggct atgttacagt ggctcacacc ggccaacatg
     6601 atctggttat cccccccaat ggttatttta ggtttgattc ttgggtcaac cagttctaca
     6661 cacttgcccc catgggaaat ggaacggggc gtagacgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg acgtccttgg atccgggctt ggttctttga tcaatgccgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaataac agaaaattgc aacaagcttc
     6841 cttccaattc agtagcaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagttgca acaggaaatg atgagagtta aacaggcaat
     6961 gctcctagag ggtggattct ttgagacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaggct ttggactgga gtgggacaag gtactgggct cccgatgcta ggactacaac
     7081 atacaatgca ggccactttt ccacccctca accctcgggg gcactgccag ggagagctaa
     7141 tcttagggct gctgtccccg ctcggggctc ctccaataca ccttctaact cttctactgc
     7201 tacctctgtg tactcaaatc aaaccacttc aacgagactt ggttctacag ctggttctgg
     7261 taccagtgtc tcgagcctcc cgtcaactgc aagggctagg agctgggtcg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgccc aaagaagttt tggactcctg
     7441 gactggcgct ttcaatacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggcg taatgtgaaa agacaaaatt gattatcttt cttttcttta gtgtctttt
//