Typing tool

Complete norovirus genomes

JX459900  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,558 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       JX459900                7558 bp    RNA     linear   VRL 10-MAY-2013
DEFINITION  Norovirus Hu/GII.4/Randwick/NSW882J/2011/AU, complete genome.
ACCESSION   JX459900
VERSION     JX459900.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Randwick/NSW882J/2011/AU
  ORGANISM  Norovirus Hu/GII.4/Randwick/NSW882J/2011/AU
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7558)
  AUTHORS   Eden,J.S., Tanaka,M.M., Boni,M.F., Rawlinson,W.D. and White,P.A.
  TITLE     Recombination within the Pandemic Norovirus GII.4 Lineage
  JOURNAL   J. Virol. 87 (11), 6270-6282 (2013)
   PUBMED   23536665
REFERENCE   2  (bases 1 to 7558)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2012) School of Biotechnology and Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
FEATURES             Location/Qualifiers
     source          1..7558
                     /organism="Norovirus Hu/GII.4/Randwick/NSW882J/2011/AU"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Randwick/NSW882J/2011/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:1241971"
                     /country="Australia"
                     /collection_date="Oct-2011"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AFV08770.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSNMAVTLKRALGARP
                     KQPPPREIQQRPPRPPTPELVKKIPPPPPNGEDEVVVSYSAKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVEQGFVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATSKDGC
                     PRPKDDGEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVAGMILEEGAPEG
                     TVVSLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKVYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AFV08771.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSTFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFSPKLGRVQFATDTDNDFDANQNTKFTPVGVIQDG
                     NTAHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="minor structural protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AFV08772.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQSQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKVLDWSGTRYWAPDARTTTYNAGRFSTPQPSGVPPGRANLRAAVPARGPSSTSS
                     NSSIATSVYSNQTTSTRLGSTAGSGTSVSSLPSSARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
     3'UTR           7514..7558
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gttgccaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acaaaatgtt ttctaacatg gctgtcactc ttaaacgagc
      121 cctcggggcg cggcctaaac agcccccccc gagggaaata caacaaagac ccccacgacc
      181 acctactcca gaactggtca aaaagatccc tcctcccccg cccaacggag aggatgaagt
      241 agtggtttct tatagtgcca aagatggcgt ttccggtttg cctgagcttt ccaccgtcag
      301 gcaaccggaa gaaaccaata cggccttcag tgtcccccca ctcaatcaga gggagaatag
      361 ggatgctaag gaaccactaa ctgggacaat tctggaaatg tgggatgggg aaatctacca
      421 ttatggcctg tatgttgagc aaggttttgt gctgggcgtg cacaagccac cagctgccat
      481 tagcctcgcc aaggtcgaat taacaccact ctccttgttc tggagacctg tgtacactcc
      541 tcagtacctc atttctccag acaccctcaa gaaattacac ggagaaacat ttccctacac
      601 agcctttgac aacaattgct atgccttttg ttgctgggtc ctggatttaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac aggcttcttc agaccctacc aagattggaa
      721 tagaaaaccc ctccccacta tggatgattc caaattaaag aaggtggcta acatattcct
      781 gtgcgccctg tcttcgctat tcactaggcc cataaaagac ataataggaa agttaaggcc
      841 tcttaacatc atcaacatcc tggcttcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ttggcggagc tctttggagt cttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttactcggtg atttcgagtt acaaggacct gaggaccttg tagtggagct
     1021 cgtccctgtg gtaatggggg ggattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 gaaaatgttg tcatctgctg catccacctt gagagcttgc aaagaccttg gtgcatatgg
     1141 actagagatc ttgaagttag tcatgaagtg gttcttcccg aagaaagagg aagcgaatga
     1201 actggccatg gtgagatcca tcgaggatgc agtactggac cttgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga tagcctggca acctacatga gaaccctcga
     1321 cctcgaggaa gagaaagcca gaaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcacttctgg cgagaatcgc cgctgcacgc tccctggtgc accgagcaaa
     1441 ggaggagctt tccagcagac caagacctgt agtcttgatg atatcaggca ggccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc tcacaggaga
     1561 ccagcgtgta ggcctcatcc cacgcaatgg cgtcgatcac tgggatgcgt acaaggggga
     1621 aagggtcgtc ctatgggacg actatggaat gagcaacccc atccacgacg ccctcaggct
     1681 gcaagaactc gctgacactt gccccctcac tctaaattgt gacaggattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcatcattat cactactaat ctggccaacc cagcaccact
     1801 ggactacgtc aactttgagg cgtgctcgag acgcatcgac ttcctcgtgt acgcagaagc
     1861 ccccgaggtc gaaaaggcga agcgcgactt cccgggccaa cctgacatgt ggaaaaacgc
     1921 ttttagttct gatttctcac acataaaatt ggcactggct ccacaaggtg gctttgataa
     1981 gaacgggaac accccgcacg ggaagggcgt catgaagact ctcaccactg gctccctcat
     2041 tgcccgggca tcagggctgc tccatgagag attggatgag ttcgaactac agggcccaac
     2101 tcttaccacc ttcaactttg accgcaacaa agtgcttgcc ttcaggcagc ttgctgctga
     2161 aaacaaatat ggattgatgg acacaatgaa agttgggagg cagctcaagg atgtcaaaac
     2221 catgccagaa cttaagcaag cactcaagaa tatctcaatc aagaagtgcc agattgtgta
     2281 cagtggttgc acctacacac ttgagtctga tggcaagggc aacgtgaaag ttgacagagt
     2341 acagagtacc tccgttcaga ccaacaatga gctggctggc gccctgcacc atctaaggtg
     2401 cgccagaatc aggtattatg ttaagtgtgt tcaggaagcc ctgtattcta tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat catcaagcgt gtgaacattc aagacttatg
     2521 gtccaagcca caagtggaaa acacagagga ggctaccagc aaggacgggt gcccaagacc
     2581 caaagatgat ggggagttcg tcatttcatc tgacgacatt aaaacagagg gtaagaaagg
     2641 gaagaacaag actggccgtg gcaagaagca cacagccttc tcaagtaaag gtctcagtga
     2701 tgaagagtat gatgaataca agagaattag agaggaaaga aatggcaagt actccataga
     2761 agagtacctc caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttta gaccaacaag
     2881 gaaacaacgt aaggaagaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 aagaaatccg gaagacttca agcccaaggg gaaactatgg gctgacgatg acagaagtgt
     3001 ggactataac gaaaaactca gttttgaggc cccaccaagc atctggtcaa ggatagtcaa
     3061 ctttggctca ggttggggct tctgggtctc ccccagcctg ttcataacat caacccacgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaattc aggtgcacaa
     3181 gtcaggcgaa ttctgtcgct tgaggttccc aaagccaata aggaccgatg tggctggcat
     3241 gatcttggaa gaaggtgcgc ccgaaggcac cgtggtctca ctactcatca aaaggtctac
     3301 tggagaactc atgcccctag cggctagaat gggaacccac gcaaccatga agattcaagg
     3361 acgcactgtt ggaggtcaga tgggcatgct tttgacagga tccaacgcca aaagcatgga
     3421 tctaggcacc acaccaggcg attgtggctg tccctacatc tacaagagag gaaacgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 ccaggggggt gagggggaag ctacacttga aggcggtgac agtaagggaa catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaactcagc accaaaacca aattctggag
     3661 atcatccaca gcaccactcc cacctggcac ctatgaacca gcctaccttg gtggcaaaga
     3721 ccccagagtc aagggtggcc cctcgctgca gcaagtcatg agggaccagc taaaaccatt
     3781 tacggagcct aggggtaagc caccaaagcc aagtgtgtta gaagctgcta agaaaaccat
     3841 catcaatgtc cttgagcaga caattgatcc acctgagaag tggtcgttcg cacaagcttg
     3901 cgcatccctt gataagacca cttctagcgg ccatccgcac cacatgcgaa aaaatgactg
     3961 ctggaacggg gagtccttca caggcaagct ggcagaccag gcttccaaag ccaacctgat
     4021 gtttgaagaa gggaagaaca tgaccccagt ctacacaggt gcacttaagg atgaattagt
     4081 caaaactgac aaagtttatg gtaagatcaa gaagaggctt ctctggggct cggacctggc
     4141 aaccatgatc cggtgtgctc gagcattcgg aggtctgatg gatgagctca aagcacactg
     4201 tgtcacactt cctgtcagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaagcattcc aggtacagat accattatga tgctgattac tctcggtggg attcaacaca
     4321 acagagagcc gtactggcag ctgctctaga aatcatggtt aaattctcct cagaaccaca
     4381 tttggctcag gtagtagcag aagaccttct ttctcctagt gtagtggatg tgggtgactt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctttgtgc gctctccgaa gtcacaaatt tgtctccaga
     4561 catcatacag gctaattctc tcttctcctt ctatggtgat gatgaaattg ttagcacaga
     4621 cataaaatta gacccagaga aattgacagc aaagctcaag gaatatgggt tgaaaccaac
     4681 ccgccctgac aaaactgaag ggccccttgt tatttctgaa gacttagacg gtttgacttt
     4741 tctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagctc
     4801 aatactcagg caaatgtact ggaccagggg ccccaatcat gaagacccat ctgaatcaat
     4861 gatcccacac tctcaaagac ccatacaatt gatgtcctta ctgggtgagg ccgcactcca
     4921 cggcccaaca ttctacagta aaatcagcaa attagtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcggatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ctattgcggc gcctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagttcacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatctaa
     5341 atccctacct atctcatttg gccagaatgt ataatggtta tgcaggtggt tttgaagtgc
     5401 aggtgatcct cgcggggaac gcgttcaccg ctggaaaaat tatatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ttgagtccca gccaggttac tatgttcccc catataatag
     5521 tagatgttag gcaattggaa cctgtgttga tccccttacc tgatgttaga aataacttct
     5581 atcattataa tcagtcaaat gattctacca ttaaattgat agcaatgctg tacacaccac
     5641 ttagggctaa taatgctggg gatgatgtct ttacagtttc ttgtcgagtt ctcacgagac
     5701 catcccccga ttttgatttc atatttttag tgccacctac agttgaatca agaactaaac
     5761 cattctctgt cccaatttta actgttgaag aaatgaccaa ttcaaggttc cccattcctt
     5821 tggaaaagtt gttcacgggc cccagtagta cctttgttgt tcaaccacaa aacggcaggt
     5881 gcacgactga tggcgtgctc ttaggtacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac attgcaggca gtcgtaacta cacaatgaat ctggcttccc
     6001 aaaattggaa cagttatgac ccaacagaag aaatcccagc ccctctagga actccagatt
     6061 tcgtggggaa gattcaaggt gtgctcaccc aaaccacaag gacagatggc tcgacccgcg
     6121 gtcacaaagc tacagtgtac actgggagtg ccgacttttc tccaaaactg ggtagagttc
     6181 aatttgccac tgacacagac aatgatttcg atgctaacca aaacacaaag ttcaccccag
     6241 tcggcgttat ccaggatgga aatactgccc accgaaatga accccaacaa tgggtgctcc
     6301 caagctactc aggcagaaac acccataatg tgcacctggc ccccgctgta gcccccactt
     6361 ttccgggtga gcaactcctc ttcttcagat ctaccatgcc cggatgcagc gggtacccca
     6421 acatggattt ggactgtctg ctcccccagg aatgggtgca gtatttctac caggaagcag
     6481 ccccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggtcc
     6541 tgtttgagtg taagcttcat aaatcaggct atgttacagt ggctcacact ggccaacatg
     6601 atttggttat cccccccaat ggttatttta gatttgactc ctgggtcaac cagttctaca
     6661 cacttgcccc catgggaaat gggacggggc gtaggcgtgc attgtaatgg ctggagcttt
     6721 ctttgctgga ttggcatctg acgtccttgg ctctggactt ggttccctaa tcaatgctgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaataac agaaaattgc aacaggcttc
     6841 cttccaattt agtagcaact tacaacaagc ttcctttcaa catgataaag agatgctcca
     6901 atcacaaatt gaggccacca aaaagctgca acaggaaatg atgagagtta aacaagcaat
     6961 gctcctagag ggtggattct ccgagacaga tgcagctcgt ggggcaatca acgcccccat
     7021 gacaaaagtt ttggactgga gcgggacaag gtactgggct cccgatgcta ggactacaac
     7081 atataatgca ggtcgctttt ccacccctca accctcgggg gtaccaccag gaagagctaa
     7141 tcttagggct gctgtccccg cccggggtcc ctccagcaca tcttctaact cttctattgc
     7201 tacttctgtg tattcgaatc agaccacttc aacgagactt ggttctacag ctggttctgg
     7261 taccagtgtc tcgagcctcc cgtcatctgc aaggactagg agctgggttg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccacaacatc tcgtttgtca ccccaccatc
     7381 tagtagatcc tctagccaag gcacagtctc aaccgtgccc aaagaagttt tggactcctg
     7441 gactggcgct ttcaatacgc gcaggcagcc tctcttcgct cacatccgta agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaattg attatctttc ttttctttag tgtctttt
//