Typing tool

Complete norovirus genomes

JX439818  GII.4 New Orleans
 GII.P4 Yerseke

Length: 7,537 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       JX439818                7537 bp    RNA     linear   VRL 31-JUL-2013
DEFINITION  Norovirus Hu/GII/Seoul1367/KOR/2010, complete genome.
ACCESSION   JX439818
VERSION     JX439818.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII/Seoul1367/KOR/2010
  ORGANISM  Norovirus Hu/GII/Seoul1367/KOR/2010
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7537)
  AUTHORS   Han,T.H., Lam,T.T.Y., Pybus,O.G., Park,S.H. and Chung,J.Y.
  TITLE     The recombinant origin of emerging humannorovirus GII.4/2008
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7537)
  AUTHORS   Han,T.H., Lam,T.T.Y., Pybus,O.G., Park,S.H. and Chung,J.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2012) Department of Pediatrics and Laboratory
            Medicine, Sanggye Paik Hospital, Inje University College of
            Medicine, 761-1 Sanggye-7Dong, Nowon-Gu, Seoul 139-707, Republic of
            Korea (South Korea)
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7537
                     /organism="Norovirus Hu/GII/Seoul1367/KOR/2010"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII/Seoul1367/KOR/2010"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1336100"
                     /country="South Korea"
                     /collection_date="24-Nov-2010"
                     /note="genotype: GII"
     CDS             5..5104
                     /codon_start=1
                     /product="nonstructural protein"
                     /protein_id="AGM46352.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELIKNIPPPPPNGEDDIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     FARVELTPLSLYWRPVYTPQYLISPDALKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDLIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNISIKKCQIVYSGSTYTLESDGKGNVKVDRVQSASVQTNNELAGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQNLWSKPQVENTEETTSKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVATGVHTAAARVGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLAISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGS
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGRRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="AGM46353.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLATQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRADGSTRGHKATVYTGSADFAPKLGRVQFATDTDNDFDANQNTKFTPVGVIQDG
                     DTAHRNEPQQWVLPSYSGRNSHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="AGM46354.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGHFSTPQPSGALPGRANLRAAVPAWGSSSTSS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARARSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRA"
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt tcaaacgagc
      121 cctcggggcg cggcctaaac agcctccccc gagggaaata ccacaaagac ccccacgacc
      181 acccactcca gaactgatta aaaacatccc ccctccccca cccaacggag aggatgacat
      241 agtggtttct tatagtgtca aagatggtgt ctctggtttg cctgatcttt ccaccgtcag
      301 gcaaccagaa gaatctaata cggccttcag tgtccctcca ctcaatcaga gggagaatag
      361 agatgctaag gagccactga ctggaacaat cctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgtagagc gaggtcttgt gctaggtgtg cacaaaccac cagctgccat
      481 cagcttcgct agggtcgaac taacaccact ttccttgtac tggagacctg tgtatactcc
      541 ccagtacctc atctctccag acgctctcaa gaaactacac ggagagacgt tcccctacac
      601 agcctttgac aacaactgct atgccttttg ttgttgggtt ctggacctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgactc caagttaaag aaggtagcta acatattcct
      781 gtgtgcactg tcttcgctat tcaccaggcc tataaaagat ttaataggga agctaaggcc
      841 tcttaacatc ctcaacatct tggcctcatg tgattggact tttgcaggca tagttgagtc
      901 cttgatactc ttggcagaac tcttcggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg attacgaact acaaggacct gaggaccttg cagtagagct
     1021 cgtccctgta gtgatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 gaaaatgttg tcatctgctg catccacctt gagagcttgt aaagatcttg gtgcatatgg
     1141 gctagagatc ctaaagttgg tcatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctata gtgagatcca tcgaggatgc agtcctggat ctcgaggcaa tcgaaaacaa
     1261 ccatatgacc accttgctca aagacaagga cagtctggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcca ggaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc tgctgcacgt tctctagtgc atcgagcgaa
     1441 ggaggaactt tctagcagac caagaccggt agtgttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc ttacaggaga
     1561 ccagcgtgta ggcctcgtcc cacgcaatgg cgtcgaccat tgggatgcgt acaaggggga
     1621 gagggtcgtt ctatgggacg actatggaat gagcaaccct atccacgatg ccctcagatt
     1681 gcaagaactc gctgacactt gccccctcac cctaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagcgatg tcatcattat caccactaat ctggctaacc cagcaccact
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccctgaggtc gaaaaggcga agcgtgactt cccaggccaa cccgacatgt ggaagaacgc
     1921 cttcagtcct gatttctcac acataaaact aacattggct ccacagggtg gcttcgacaa
     1981 gaacgggaac accccacacg ggaagggcgt catgaagact ctcaccaccg gctcccttat
     2041 tgcccgggca tcagggctac tccatgagag gctagatgaa tttgaactac agggcccaac
     2101 tctcaccacc ttcaactttg atcgcaataa agtgcttgcc tttagacaac ttgctgctga
     2161 aaataaatat gggttgatgg acacaatgaa agttgggagg cagctcaagg atgtcagaac
     2221 aatgccagag ctcaagcaag cactcaagaa tatttcaatc aagaagtgcc agatagtgta
     2281 tagtggtagc acctacacac ttgagtctga tggcaagggc aatgtgaagg ttgacagagt
     2341 tcaaagcgcc tccgtgcaga ccaacaatga gctggctggc gccctacacc atctaaggtg
     2401 cgccagaata agatactatg ttaggtgtgt ccaggaggcc ctgtattcca tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aaaacctatg
     2521 gtctaagcca caagtggaaa atacagagga gactactagc aaggacgggt gtccaaaacc
     2581 caaagatgat gaggagttcg tcatttcatc cgacgacatc aaaactgagg gcaagaaagg
     2641 gaaaaacaag actggtcgcg gcaagaagca cacagccttc tcaagcaaag gtctcagtga
     2701 tgaagaatac gatgaataca agagaattag agaagaaagg aacggtaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgactga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttta ggccaacaag
     2881 gaaacaacgc aaggaggaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 aagaaatcca gatgatttca aacccaaagg gaaactgtgg gctgacgatg acagaagtgt
     3001 ggactacaat gagaaactca gttttgaagc cccaccaagc atctggtcga gaatagtcag
     3061 ctttggttca ggctgggggt tctgggtctc ccccagtttg ttcataacat caacccatgt
     3121 cataccccag ggagcaaagg agttctttgg agtccccatc aaacaaattc aggtacacaa
     3181 gtcaggcgaa ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacgggtat
     3241 gatcttagaa gaaggtgcac ccgagggcac cgtggtcaca ctgctcatca aaaggcccac
     3301 tggagaactc atgcccctag cagctaggat ggggacccat gcaaccatga aaatccaagg
     3361 acgcactgtt ggaggtcaaa tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 tctgggtacc acaccaggtg attgtggctg tccctacatc tacaagagag gaaatgacta
     3481 tgtggccact ggagtccaca cggctgccgc tcgtgtgggc aacactgtca tatgtgccac
     3541 ccaggggagt gagggagagg ctacacttga aggtggtgac aataaaggga catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaagacca aattctggag
     3661 atcgtccaca gcaccactcc cacctggcac ctatgaacca gcctatcttg gtggcaagga
     3721 ccccagagtc aagggtggcc cttcactaca gcaggtcatg agggatcagc tgaagccatt
     3781 cacagagccc aggggcaagc caccaaagcc aagtgtgttg gaagctgcta agaaaaccat
     3841 catcaatgtc cttgaacaaa ctattgatcc acctgagaaa tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacca cctccagtgg ccatccgcat cacatgcgga aaaatgactg
     3961 ctggaacggg gagtccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgacgccagt ctatacagct gcgcttaagg acgaattagt
     4081 taaaactgac aaaatttatg gcaagatcaa aaagaggctt ctctggggct cggatttggc
     4141 gaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcgcactg
     4201 tgtcacactt cccattagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaggcactct aggtacacat accactatga tgctgattac tctcgatggg attcaacaca
     4321 acagagagcc gtgttggcag cagctctaga aatcatggtt aagttctccc cagaaccaca
     4381 tttggcccag gtagtcgcag aagaccttct ttctcctagc gtggtggacg tgggtgactt
     4441 cacaatatca attaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ccctctgtgc gctctctgaa gttacaaatt tgtctcctga
     4561 caccatacaa gctaattccc tcttctcttt ttatggtgat gatgaaattg ttagcacaga
     4621 cataaaattg gatccagaaa agttgacagc aaaactcagg gaatatgggt taaaaccaac
     4681 ccgtcccgac aaaactgaag gaccccttgc catctctgaa gacttgaatg gcctgacttt
     4741 cctacggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg ctccaaccat gaagacccat ctgaaacaat
     4861 gattccacac tcccaaaggc ccatacaact gatgtcccta ctgggggagg ccgcgctcca
     4921 cggcccagca ttctacagca agatcagcaa gttagtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggccggc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ctattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaacaatt ttgtacaagc ccctggtgga gagttcacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatttga
     5341 atccctacct ttcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtagtcct cgcggggaac gcgttcaccg ccggaaaaat catatttgca gcagtcccac
     5461 caaatttccc aactgaaggc ttgagcccca gccaggtcac tatgttcccc cacataatag
     5521 tagatgttag gcaattggaa cctgtgttga tccccttacc cgatgttagg aataatttct
     5581 atcactacaa tcaatcaaat gaccccacca tcaaattgat agccatgttg tatacaccac
     5641 ttagggctaa taatgctggg gacgatgtct tcacagtttc ttgtcgggtt ctcacgagac
     5701 catcccccga ttttgacttc atatttttag taccacccac agttgagtca agaactaaac
     5761 cattctctgt cccaatttta actgttgagg agatgaccaa ttcaagattc cccattcctt
     5821 tggaaaagct gttcacgggt cccagcagtg cctttgttgt tcaaccacaa aacggcagat
     5881 gcacgactga tggcgtgctc ctaggtacca ctcaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccat atcacaggta gtcgtaacta cacaatgaat ttggctactc
     6001 aaaattggaa cagttatgac ccaacagaag aaatcccagc ccctctagga actccagatt
     6061 tcgtggggaa gattcaaggt gtgctcaccc aaaccacaag ggcagatggc tcgacccgcg
     6121 gccacaaagc tacagtgtac actgggagcg ccgattttgc tccaaaactg ggtagagttc
     6181 aatttgccac tgacacagac aatgattttg atgctaacca aaacacaaag ttcaccccag
     6241 tcggtgtcat ccaggatggt gacactgccc accgaaatga accccaacaa tgggtgctcc
     6301 caagttactc aggcagaaat agtcacaatg tgcacctggc ccccgctgta gcccccactt
     6361 ttccgggtga gcaacttctc ttcttcagat ccactatgcc cggatgcagc gggtacccca
     6421 acatggattt ggactgcctg ctcccccagg aatgggtgca gtatttctat caagaggcag
     6481 ccccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg taaacttcat aaatcaggct atgttacagt ggctcacacc ggtcaacatg
     6601 atttggttat cccccccaat ggttatttta gatttgattc ctgggtcaac cagttctaca
     6661 cacttgcccc catgggaaat ggaacggggc gtagacgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg acgtccttgg ctccggactt ggttctctga tcaatgccgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaataac agaaaattgc aacaagcttc
     6841 cttccaattt agcagtaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagttgca acaggaaatg atgagagtta aacaggcaat
     6961 gctcctagag ggtggattct ctgagacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaggct ttggactgga gtgggacaag gtactgggct cccgatgcta ggaccacaac
     7081 atacaatgca ggccactttt ccacccctca accctcgggg gcactgccag gaagagctaa
     7141 tcttagggct gctgtccccg cttggggctc ctccagcaca tcttctaact cttctactgc
     7201 cacttctgtg tactcaaatc aaactacttc aacgagactt ggttctacag ctggttctgg
     7261 taccagtgtc tcgagcctcc cgtcaactgc aagggctagg agctgggttg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgccc aaagaagttt tggactcctg
     7441 gactggcgct ttcaatacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggcg taatgtgaaa agacaaattt gattata
//