Typing tool

Complete norovirus genomes

JX439815  GII.4 New Orleans
 GII.P4 Hunter

Length: 7,538 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       JX439815                7538 bp    RNA     linear   VRL 31-JUL-2013
DEFINITION  Norovirus Hu/GII/Seoul1055/KOR/2010, complete genome.
ACCESSION   JX439815
VERSION     JX439815.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII/Seoul1055/KOR/2010
  ORGANISM  Norovirus Hu/GII/Seoul1055/KOR/2010
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7538)
  AUTHORS   Han,T.H., Lam,T.T.Y., Pybus,O.G., Park,S.H. and Chung,J.Y.
  TITLE     The recombinant origin of emerging humannorovirus GII.4/2008
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7538)
  AUTHORS   Han,T.H., Lam,T.T.Y., Pybus,O.G., Park,S.H. and Chung,J.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-JUL-2012) Department of Pediatrics and Laboratory
            Medicine, Sanggye Paik Hospital, Inje University College of
            Medicine, 761-1 Sanggye-7Dong, Nowon-Gu, Seoul 139-707, Republic of
            Korea (South Korea)
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7538
                     /organism="Norovirus Hu/GII/Seoul1055/KOR/2010"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII/Seoul1055/KOR/2010"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1336082"
                     /country="South Korea"
                     /collection_date="27-Apr-2010"
                     /note="genotype: GII"
     CDS             5..5104
                     /codon_start=1
                     /product="nonstructural protein"
                     /protein_id="AGM46343.1"
                     /translation="MKMASNDASAAAVANSNNDTVKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELIKNIPPPPPNGEDDIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRESREAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELTPLSLYWRPVYTPQYLISPDALKRLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTYLAREV
                     AKRIAASLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNISIKKCQIVYSGSTYTLESDGKGNVKVDRVQSASVQTNNELAGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQSLWSKPQVENTEETTSKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     YGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLAISEDLNGLTFLRRAVTRDPAGWFGKLEQSSILRQMYWTRGS
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGARNLAPSFVNEDGVE"
     CDS             5085..6707
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="AGM46344.1"
                     /translation="MKMASNDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLATQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRADGSTRGHKATVYTGSADFAPKLGRVQFATDTDNDFDANQNTKFTPVGVIQDG
                     DTAHRNEPQQWVLPSYSGRNSHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="AGM46345.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGHFSTPQPSGALPGRANLRTAVPARGSSSISS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaata gcaacaacga
       61 caccgtaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt tcaaacgagc
      121 cctcggggcg cggcctaaac agcctccccc gagggaaata ccacaaagac ccccacgacc
      181 acccactcca gaactgatca aaaatatccc ccctccccca cccaatggag aggatgacat
      241 agtggtttct tatagcgtca aagatggtgt ctctggtttg cctgatcttt ccaccgtcag
      301 gcaaccggaa gaatctaata cggccttcag tgtccctcca ctcaatcaga gggagagtag
      361 agaagctaag gaaccactga ctggaacaat tttggaaatg tgggatggag aaatctatca
      421 ctatggcctg tacgtagagc gaggtcttgt gctaggtgtg cacaaaccac cagctgccat
      481 cagcctcgct agggtcgaac taacaccact ttccttgtac tggagacctg tgtatactcc
      541 ccagtacctc atctctccag acgctctcaa gagactacac ggagagacgt tcccctacac
      601 agcctttgac aacaactgct acgccttttg ttgttgggtc ctggacctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgactc caagttaaag aaggtggcta acatattcct
      781 gtgtgcattg tcttcgctat tcaccaggcc tataaaagat ataataggga agctaaggcc
      841 tcttaacatc cttaacatct tggcctcatg tgattggact tttgcaggca tagtggagtc
      901 cttgatactc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg actacgaact acagggacct gaggaccttg cagtggagct
     1021 cgtccctgta gtgatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catccacctt gagagcttgt aaagatcttg gtgcatatgg
     1141 gctagagatc ctaaagttgg ttatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctata gtgagatcca tcgaggatgc agtcctggat ctcgaagcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagtctggca acctacatga aaacccttga
     1321 ccttgaggag gagaaagcca ggaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc tgctgcacgt tctctggtgc atcgagcgaa
     1441 ggaggaactt tctagcagac caagacctgt agtgttgatg atatcaggca gaccaggaat
     1501 agggaagacc taccttgcca gagaagtggc taagagaatc gcagcctccc ttacaggaga
     1561 ccagcgtgta ggcctcgtcc cacgcaatgg cgtcgaccat tgggatgcgt acaaggggga
     1621 gagggtcgtt ctatgggacg actatggaat gagcaatcct atccacgatg ccctcagatt
     1681 gcaagaactc gctgacactt gtcccctcac cctaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagcgatg tcatcattat caccactaat ctggctaacc cagcaccact
     1801 ggactatgtc aacttcgaag catgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccctgaggtc gaaaaggcga agcgtgactt cccaggccaa cccgacatgt ggaagaacgc
     1921 cttcagtcct gatttctcac acataaaact aacattggct ccacagggtg gtttcgacaa
     1981 gaacgggaac accccacacg ggaagggcgt catgaagact ctcaccaccg gctcccttat
     2041 tgcccgggca tcagggctac tccatgagag gctagatgaa tttgaactac agggcccaac
     2101 tctcaccact ttcaactttg atcgcaataa agtgcttgcc tttagacaac ttgctgctga
     2161 aaacaaatat gggttgatgg acacaatgaa agttgggagg cagctcaagg atgtcagaac
     2221 aatgccagag ctcaagcaag cactcaagaa tatttcaatc aagaagtgcc agatagtgta
     2281 cagtggtagc acctacacac ttgagtctga tggcaagggt aatgtgaagg ttgacagagt
     2341 tcaaagcgcc tccgtgcaga ccaacaatga gctggctggc gccctacacc atctaaggtg
     2401 cgccagaata agatactatg tcaggtgtgt ccaggaggcc ctgtattcca tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aaagcctatg
     2521 gtctaagcca caagtggaaa atacagagga gactaccagc aaggacgggt gtccaaaacc
     2581 caaagatgat gaggagttcg tcatttcatc cgacgacatc aagactgagg gcaagaaagg
     2641 gaaaaacaag actggccgcg gtaagaagca cacagccttc tcaagcaaag gtctcagtga
     2701 tgaagagtac gatgagtaca agaggattag agaagaaagg aatggtaagt actcaataga
     2761 agagtacctt caagacaggg acaaatacta tgaggaggtg gccattgcca gggcgactga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttca ggccaacaag
     2881 gaaacaacgc aaggaggaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 aagaaatcca gatgatttca aacccaaggg gaaactgtgg gctgacgatg acagaagtgt
     3001 ggactacaat gagaaactca gttttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggat tctgggtctc ccccagtttg ttcataacat caacccatgt
     3121 cataccccag ggagcaaagg agttctttgg agtccccatc aaacaaattc aggtacataa
     3181 gtcaggcgaa ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcac ccgagggcac cgtggttaca ctactcatca aaaggtccac
     3301 tggggaactc atgcccctag cagctaggat ggggacccat gcaaccatga aaatccaagg
     3361 acgcactgtt ggaggtcaaa tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 tctgggtacc acaccaggtg attatggctg tccctacatc tacaagagag gaaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtgggggc aacactgtca tatgtgccac
     3541 ccaggggagt gagggagagg ctacacttga aggtggtgac aataaaggga catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaagacca aattctggag
     3661 atcgtccaca gcaccactcc cacctggcac ctatgaacca gcctatcttg gtggtaagga
     3721 tcccagagtc aagggtgggc cttcactaca gcaggtcatg agggatcagc tgaagccatt
     3781 cacagagccc aggggcaagc caccaaagcc aagtgtgttg gaagctgcta agaaaaccat
     3841 catcaatgtc cttgagcaaa caattgatcc acctgagaaa tggtcgttcg cacaagcttg
     3901 cgcgtccctt gataagacca cctccagtgg ccacccgcat cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgacgccagt ctacacagct gcgcttaagg atgaattagt
     4081 taaaactgac aaaatttatg gcaagatcaa gaagaggctt ctctggggct cggatttggc
     4141 gaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcgcactg
     4201 tgtcacactt cccattagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaggcactcc aggtacacgt accactatga tgctgattac tctcgatggg attcaacaca
     4321 acagagagcc gtgttggcag cagctctaga aattatggtt aagttctccc cagaaccaca
     4381 tttggcccag gtagtcgcag aggaccttct ttctcctagc gtggtggacg tgggtgactt
     4441 cacaatatca attaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ccctctgtgc gctctctgaa gttacaaact tgtctcctga
     4561 caccatacaa gctaattccc tcttctcttt ttatggtgat gatgaaattg ttagcacaga
     4621 cataaaattg gacccagaaa agttgacagc aaagctcagg gaatatgggt taaaaccaac
     4681 ccgccccgac aaaactgaag gaccccttgc catctctgaa gacttgaatg gcctgacttt
     4741 cttgcggaga gctgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg ttccaaccat gaagacccat ctgaaacaat
     4861 gattccacac tcccaaagac ccatacaact gatgtcccta ctgggggagg ccgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa gttagtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgctc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ccattgcggc gcctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaacaatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatttga
     5341 atccctacct ttcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccggaaaaat catatttgca gcagtcccac
     5461 caaatttccc aactgaaggc ttgagcccca gccaggtcac tatgttcccc cacataatag
     5521 tagatgttag gcaactggaa cctgtgttga tccccttacc cgatgttagg aataatttct
     5581 atcactacaa tcaatcaaat gaccccacca tcaaattgat agccatgttg tatacaccac
     5641 ttagggctaa taatgctggg gacgatgtct tcacagtttc ttgtcgggta ctcacgagac
     5701 catcccccga ttttgatttc atatttctag tgccacccac agttgaatca agaactaaac
     5761 cattctctgt cccaatttta actgttgagg agatgaccaa ttcaagattc cccattcctt
     5821 tggaaaagct gttcacgggc cctagcagtg cctttgttgt tcaaccacaa aacggcaggt
     5881 gcacgactga tggcgtgctc ctgggtacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccat attacaggta gtcgtaacta cacaatgaat ttggctactc
     6001 aaaattggaa cagttatgac ccaacagaag aaatcccagc ccctctagga actccagatt
     6061 tcgtgggaaa gatccaaggt gtgctcaccc aaaccacgag ggcagatggc tcgacccgtg
     6121 gccacaaagc tacagtgtac actgggagcg ccgactttgc tccaaaactg ggtagagttc
     6181 aatttgccac tgacacagac aatgattttg atgctaacca aaacacaaag ttcaccccag
     6241 tcggtgtcat ccaggatggt gatactgccc accgaaatga accccaacaa tgggtgctcc
     6301 caagttactc aggcagaaat agtcacaatg tgcacctggc ccccgctgta gcccccactt
     6361 ttccgggcga gcaacttctc ttcttcagat ccactatgcc cggatgcagc gggtacccca
     6421 acatggattt ggactgtctg cttccccagg aatgggtgca gtatttctat caagaggcag
     6481 ccccagcaca atctgatgtg gcactgctaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg taagcttcat aaatcaggct atgttactgt ggctcacacc ggccaacatg
     6601 atttggttat cccccccaat ggttatttca gatttgattc ctgggtcaac cagttctaca
     6661 cacttgcccc catgggaaat ggaacggggc gtagacgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg acgtccttgg atccggactt ggttctctga tcaatgccgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaacaac agaaaattgc aacaagcttc
     6841 cttccaattt agtagcaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagttgca acaggaaatg atgagagtta aacaggcaat
     6961 gctcctagag ggtggattct ctgagacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaggct ttggactgga gtgggacaag gtactgggct cccgatgcta ggactacaac
     7081 atacaatgca ggccactttt ccactcctca accctcgggg gcactgccag gaagagctaa
     7141 tcttaggact gctgtccccg ctcggggctc ctctagcata tcttctaact cttctactgc
     7201 tacctctgtg tactcaaatc aaactacttc aacgagactt ggttctacag ctggttctgg
     7261 taccagtgtc tcgagcctcc cgtcaactgc aaggactagg agttgggttg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgccc aaagaagttt tggactcctg
     7441 gactggcgct ttcaatacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaattt gattataa
//