Typing tool

Complete norovirus genomes

JX126912  GII.4 Farmington Hills
 GII.P4 Farmington Hills

Length: 7,558 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       JX126912                7558 bp    RNA     linear   VRL 20-AUG-2012
DEFINITION  Norovirus Hu/GII.4/Ohio/7I/2012/USA, complete genome.
ACCESSION   JX126912
VERSION     JX126912.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Ohio/7I/2012/USA
  ORGANISM  Norovirus Hu/GII.4/Ohio/7I/2012/USA
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7558)
  AUTHORS   Ma,Y., Hughes,J.H. and Li,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUN-2012) Department of Food Science and Technology,
            The Ohio State University, 2015 Fyffe Road, Columbus, OH 43210, USA
FEATURES             Location/Qualifiers
     source          1..7558
                     /organism="Norovirus Hu/GII.4/Ohio/7I/2012/USA"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Ohio/7I/2012/USA"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1221623"
                     /country="USA"
                     /collection_date="2012"
                     /note="genotype: GII.4"
     CDS             5..5104
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AFP89592.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARS
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEIVISYSVKDGVSGLPELSTVRQPE
                     EANTAFSVPPLNQRENRDAREPLTGTILEMWDGEIYHYGLYVDRGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTVDDSKLKKVANIFLCALSSLFTRPIKDLIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAVENNHMTTLLKDKDSLATYMRTLDLEEEKARKLSA
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGRQLEDVRTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTSNELTGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQNLWSKPQVENTEEVTNKDGC
                     PKPKDDEEFIISSDDIKTEGKKGKNKAGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERVSLGLV
                     TGSEIRKRNPDEFKPKGKLWADDDRSVDYNKKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TAVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSETTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="AFP89593.1"
                     /translation="MKMASNDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNSYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSGAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGTHNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGRIQGML
                     TQTTRGDGSTRGHKATVSTGDVHFTPKLGSIQFNTDTNNDFETGQNTKFTPVGVIQDG
                     NGTHQNEPQQWVLPSYSGRTGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRVL"
     CDS             6707..7513
                     /note="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="AFP89594.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLISAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQGMMEVKRAMLLEGGFSETDASRGAIN
                     APMTKALDWSGTRYWAPDARTTTYNTGRFSTPQPSGALPGRTNPRATVPARGFSNAPS
                     NTSTATSVYSNQTVSTRLGSTAGSGTSVSSLPSTARTRSWIEDQNRDLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQLLFAHIRKRGESRA"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggtctaaac agcccccccc gagggaaata ccacaaagac ccccacgacc
      181 acccactcca gaactggtca aaaagatccc tcctcccccg cccaacggag aggatgaaat
      241 agtgatttct tatagtgtca aagatggcgt ttccggttta cctgagcttt ccaccgtcag
      301 gcaaccggaa gaagctaata cggcctttag tgtccccccg ctcaatcaga gggagaatag
      361 ggatgctagg gagccactga ctggaacaat tctggaaatg tgggatgggg aaatctacca
      421 ttacggcctg tatgtggacc gaggtcttgt actaggcgtg cacaaaccac cagctgccat
      481 cagcctcgcc aaggtcgaac taacaccact ctccttgttc tggagacctg tgtacactcc
      541 tcagtacctc atctctccag acactctcaa gaaattacac ggagaaacgt tcccttacac
      601 agcctttgac aacaattgct atgccttttg ctgctgggtc ctggacctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccactg tggatgattc caagttaaag aaggtagcta atatattcct
      781 gtgtgctctg tcttcgctgt tcaccaggcc cataaaagac ttaataggga agctaaggcc
      841 tcttaacatc ctcaacatct tggcctcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ctggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg actacgagtt acaaggaccc gaggaccttg cagtggagct
     1021 cgtccctgta gtgatggggg gaattggttt ggtgctggga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatccgctg cgtccacctt gagagcttgc aaagatcttg gtgcatatgg
     1141 gctagagatc ctaaagttgg tcatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtgctggac ctcgaggcag ttgagaacaa
     1261 ccatatgacc accttgctca aagacaagga tagtttggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcca gaaaactctc agccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaat gcccttctgg cgagaatcgc tgctgcacgt tccctggtgc atcgagcgaa
     1441 ggaggagctt tccagcagac caagacctgt agtcttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc tcacaggaga
     1561 ccagcgtgta ggcctcatcc cacgcaatgg cgtcgatcac tgggatgcgt acaaggggga
     1621 gagggtcgtc ctgtgggacg actatggaat gagcaatccc atccacgacg ccctcaggct
     1681 gcaagaactc gctgacactt gccccctcac tctaaactgt gacaggatag agaataaagg
     1741 aaaggtcttt gacagcgatg tcatcattat cactactaac ctggccaacc cagcaccact
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgat ttcctcgtgt atgcagaagc
     1861 ccctgaagtc gaaaaggcga agcgtgactt cccaggccaa cctgacatgt ggaagaatgc
     1921 ctttagttct gatttctcac acataaaact agcactggct ccacagggtg gcttcgataa
     1981 aaacgggaac accccgcacg ggaagggcgt catgaagact ctcaccactg gctcccttat
     2041 tgcccgggca tcagggctac tccatgagag gctagatgag tttgaactac agggcccagc
     2101 tctcaccacc ttcaactttg accgcaacaa agtgcttgcc tttaggcagc ttgctgctga
     2161 aaacaaatat gggttgatgg acacaatgag agttgggagg cagctcgagg atgtcagaac
     2221 catgccagag cttaaacaag cactcaagaa tatctcaatc aagaagtgcc agatagtgta
     2281 cagtggttgc acctacacac ttgagtctga cggcaagggc aatgtgaaag ttgacagagt
     2341 tcagagcacc tccgtgcaga ccagcaatga gctgactggc gccctgcacc acctaaggtg
     2401 tgccagaatc aggtactatg tcaggtgtgt ccaggaggcc ctgtactcca ttatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aaaacctatg
     2521 gtccaagcca caagtggaaa acacagagga ggttaccaac aaggacgggt gcccaaaacc
     2581 caaagatgat gaggagttca tcatttcatc cgacgacatt aaaactgagg gtaagaaagg
     2641 gaagaacaaa gctggtcgcg gcaagaagca cacagccttc tcaagcaaag gtctcagtga
     2701 tgaagagtat gatgagtaca agaggattag agaagagagg aatggcaagt attccataga
     2761 agagtacctc caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttta ggccaacaag
     2881 aaaacaacgt aaggaggaaa gagtttctct cggtttagtc acaggttctg aaattaggaa
     2941 aagaaaccca gatgaattca agcccaaggg gaaactgtgg gctgacgatg acagaagtgt
     3001 ggattacaat aagaaactca gctttgaggc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggct tctgggtctc ccccagtctg ttcataacat caacccatgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaattc aggtacacaa
     3181 atcaggcgaa ttctgtcgcc taagattccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcgc ccgagggcac cgcggtcaca ctactcataa aaaggtctac
     3301 aggagaactc atgcccctag cagctagaat ggggacccat gcaaccatga aaattcaagg
     3361 gcgtactgtt ggaggtcaga tgggcatgct tctgacagga tctaacgcca aaagcatgga
     3421 cctaggcacc acaccaggtg attgcggctg tccctacatc tacaagagag ggaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggggga aatactgtca tatgtgccac
     3541 ccaggggagt gagggggagg ctacacttga aggtggtgac agtaagggaa catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaaaacca aattctggag
     3661 atcgtccaca gcaccactcc cacctggcac ctatgaacca gcctatcttg gtggcaagga
     3721 tcccagggtc aagggtggcc cttcattgca gcaagtcatg agggaccagt tgaaaccatt
     3781 tacagagccc aggggaaagc caccaaagcc aagtgtgtta gaagctgcca agaaaactat
     3841 catcaatgtc cttgagcaaa caattgatcc acctgagaaa tggtcattcg cacaagcttg
     3901 cgcgtccctc gacaagacca cttccagtgg ccacccgcat cacatgcgga aaaacgactg
     3961 ctggaacggg gaatccttca caggcaagct ggcagatcag gcttccaagg ccaacctgat
     4021 gttcgaagaa gggaaaaaca tgaccccagt ctacacaggt gcgcttaagg atgaattggt
     4081 caaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct cggatttagc
     4141 aaccatgatc cgatgtgctc gagcgttcgg aggcctaatg gatgaactca aagcgcactg
     4201 tgtcacactt cctatcagag ttggtatgaa tatgaatgag gatggcccca tcatattcga
     4261 gaggcattcc aggtacagat atcactatga tgctgattac tctcggtggg attcaacaca
     4321 acagagagct gtgttggcag cagctctaga aatcatggtt aaattctcct cagaaccaca
     4381 tttggctcag gtagtcgcag aagaccttct ttctcctagc gtggtggatg tgggtgactt
     4441 cacaatatca atcaacgagg gcctcccctc tggggtaccc tgcacctccc aatggaactc
     4501 catcgcccat tggcttctca ctctctgcgc gctctctgaa actacaaatc tgtcccctga
     4561 catcatacag gctaattccc tcttctcctt ttatggtgat gatgaaatcg ttagcacaga
     4621 cataaaattg gacccagaga agttgacagc aaagctcagg gaatatgggc tgaaaccaac
     4681 ccgccctgac aaaactgaag ggccccttgt tatctctgaa gacttaaatg gtctgacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg ccccaaccat gaagacccat ctgaaacaat
     4861 gattccacac tcccaaagac ccatacagtt gatgtcctta ctgggagagg ccgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa gttagtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ctattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttgggc cctgatctga
     5341 atccctacct ttctcatttg gccaggatgt acaatagcta tgcaggtggc tttgaagtgc
     5401 aggtaatcct tgcggggaac gcgttcaccg ccgggaaaat catatttgca gcagtcccac
     5461 caaatttccc aactgaaggc ttgagcccca gccaggtcac tatgttcccc catataatag
     5521 tagatgttag gcaactggaa cctgtgttga tccccttacc tgatgttagg aacaatttct
     5581 atcactacaa ccaatcaaat gaccccacca ttaaattgat agcaatgctg tacacaccac
     5641 ttagggctaa taatgctggg gaagatgtct tcacggtctc ttgtcgagtc ctcacgaggc
     5701 catcccccga ttttgatttc atattcttgg tgccacccac agttgagtca agaactaaac
     5761 cattcaccgt cccaatttta actgttgaag aaatgaccaa ttcaagattc cctattcctt
     5821 tggaaaagtt gttcacgggc cctagcggtg cctttgttgt tcaaccacaa aatggcaggt
     5881 gcacgactga tggcgtactc ttaggcacta cccaactgtc tcctgtcaac atttgcacct
     5941 tcagagggga tgtcacccac attgcaggca ctcataatta cacaatgaat ttggcttctc
     6001 aaaattggaa caattatgac ccaacagaag aaatcccagc ccctctgggg accccagact
     6061 tcgtgggaag gatccaaggc atgctcaccc aaaccacaag gggagatggc tccacccgcg
     6121 gccacaaagc tacagtgagc actggggatg tccacttcac tccaaagctg ggtagtattc
     6181 aattcaacac tgatacaaac aatgattttg aaactggcca aaacacgaaa ttcaccccag
     6241 tcggtgttat ccaggatggc aatggtaccc accaaaatga acctcaacaa tgggtgctcc
     6301 caagttactc aggtagaact ggtcataatg tacacctagc ccccgccgta gcccccactt
     6361 ttccgggtga gcagcttctt ttcttcaggt ccactatgcc cggatgcagc gggtacccca
     6421 acatgaatct ggattgccta ctcccccaag aatgggtgca gcacttctat caagaggcag
     6481 ctccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttc
     6541 tatttgagtg caagctccat aaatcaggct acgtcacagt tgctcacact ggccagcatg
     6601 atttggttat cccccccaat ggctacttta gatttgattc ctgggtcaac caattctaca
     6661 cacttgcccc catgggaaat gggacggggc gcagacgtgt attataatgg ctggagcttt
     6721 cttcgccggg ctggcatctg atgttcttgg ctctggactt ggttccttaa tcagtgctgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaataac agaaaactgc aacaagcttc
     6841 cttccaattt agtagcaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacta aaaagttgca acagggtatg atggaagtta aacgggcaat
     6961 gctcctagag ggtggattct ctgaaacaga tgcatcccgt ggggcaatca acgcccccat
     7021 gacaaaggct ttggactgga gcggaacaag gtactgggct cctgatgcta ggactacaac
     7081 atacaataca ggccgctttt ccacccctca accctcgggg gcactgccag gaaggaccaa
     7141 tcccagggct actgtccccg cccggggctt ctccaatgca ccttctaata cttctactgc
     7201 tacttctgtg tattcaaatc aaactgtttc aacgagactt ggttctacag ctggttctgg
     7261 caccagtgtc tcgagtctcc cgtcaactgc aaggactagg agctggattg aggatcaaaa
     7321 cagggatttg tcacctttca tgaggggagc tcacaacata tcgtttgtca ccccaccatc
     7381 tagtagatcc tctagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct tttaacacgc gcaggcagct tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggca taatgtgaaa agacaaaatt gattatcttt ctcttcttta gtgtcttt
//