Typing tool

Complete norovirus genomes

JX023286  GII.4
 GII.P39

Length: 7,549 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6704
ORF3: 6704..7510
LOCUS       JX023286                7549 bp ss-RNA     linear   VRL 20-SEP-2012
DEFINITION  Norovirus Hu/GII.4/CHDC5191/1974/USA, complete genome.
ACCESSION   JX023286
VERSION     JX023286.1
DBLINK      BioProject: PRJNA70471
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/CHDC5191/1974/USA
  ORGANISM  Norovirus Hu/GII.4/CHDC5191/1974/USA
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7549)
  AUTHORS   Madupu,R., Halpin,R., Ransier,A., Fedorova,N., Stockwell,T.,
            Amedeo,P., Bishop,B., Edworthy,P., Gupta,N., Katzel,D., Li,K.,
            Schobel,S., Shrivastava,S., Thovarai,V., Wang,S., Kim,M., Bok,K.,
            Sosnovtsev,S.V., Wentworth,D.E. and Green,K.Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-APR-2012) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: clc_ref_assemble_long v. 3.20.50819
            Coverage              :: 131.03x
            Sequencing Technology :: Illumina; 454; Sanger
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..7549
                     /organism="Norovirus Hu/GII.4/CHDC5191/1974/USA"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/CHDC5191/1974/USA"
                     /host="Homo sapiens"
                     /db_xref="taxon:1184497"
                     /country="USA: District of Columbia"
                     /collection_date="10-Jul-1974"
                     /note="genotype: GII.4"
     gene            5..5104
                     /gene="POL"
     CDS             5..5104
                     /gene="POL"
                     /note="genome polyprotein"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AFJ38518.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELIKKVPPPPPNGEDEPVVSYNAKNGVSGLPELSTVRQPD
                     ENNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LKPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEASELAMVRSIEDAVLDLEAIENNHLTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLAREL
                     AKKIATTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPDVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTIGSLIARA
                     SGLLHERLDEYELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGGQLKGVRTM
                     PELKQALKNISIKRCQIVYGGSTYTLESDGKGSVRVDRVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQLEDTEEATGKDGC
                     PKPKDDEEFVVSSDDIKVEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGTQEFFGVSIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRIKGGPSLQQVMRDQLKPFTEP
                     RGKQPKPSVLEAAKRTIINVLEQTIDPPQKWTFAQACASLDKTTSSGHPHHIRKNECW
                     NGDSFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAILAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIVQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLIISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPTQLMSLLGEAALHGPAFYSKISKLVITELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     mat_peptide     5..994
                     /gene="POL"
                     /product="protein p48"
     mat_peptide     995..2092
                     /gene="POL"
                     /product="NTPase"
                     /note="p41"
     mat_peptide     2093..2629
                     /gene="POL"
                     /product="protein p22"
     mat_peptide     2630..3028
                     /gene="POL"
                     /product="viral genome-linked protein"
                     /note="VPg"
     mat_peptide     3029..3571
                     /gene="POL"
                     /product="3C-like protease"
                     /note="3CLpro; calicivirin"
     mat_peptide     3572..5101
                     /gene="POL"
                     /product="RNA-directed RNA polymerase"
     gene            5085..6704
                     /gene="VP1"
     CDS             5085..6704
                     /gene="VP1"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="AFJ38519.1"
                     /translation="MKMASSDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNIIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQAHDSTLKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMSNSRFPIPLEKLYTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSAVNICNFRGDVTRVGISHDYTMNLVSQNWNNYDPTEEIPAPLGTPDFVGKIQGLL
                     TQTTRADGSTRAHKATVSTGSVHFTPKLGSVQFTTDTNNDFQTGQNTKFTPVGVIQDG
                     DHHQNEPQQWVLPNYSGTSGHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLDC
                     LLPQEWVLHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYITVAHTGPYDLVI
                     PPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     gene            6704..7510
                     /gene="VP2"
     CDS             6704..7510
                     /gene="VP2"
                     /note="minor capsid protein"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="AFJ38520.1"
                     /translation="MAGPFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATQKLQQGLMKVKQAVLLEGGFSTTDAARGAIN
                     APMTKALDWSGTRYWAPDARATTYNAGRFSTPQPLGALPGRINPRVPAPARSSPSSLS
                     NAPTATSVYSNQTVSTRLGSSAGSGAGVSSLPSTARTRSWVEDQNRNLSPFMRGALNT
                     SFVTPPSSRSSNQGTVSTVPKEILDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtact ttctagtatg gctgtcacct ttaaacgagc
      121 cctcggggcg cggcctaagc agccgccccc gagggagata ccacaaagac ccccacgacc
      181 gcccactccg gagttgatca agaaggtccc tccccccccg cccaacgggg aggacgaacc
      241 agtggtttct tacaacgcca agaatggcgt ttctggactg cctgagcttt ccactgtcag
      301 gcaaccagat gagaacaaca cggcatttag tgtcccccca cttaaccaaa gggagaacag
      361 ggatgccaag gagccactaa ctggaacaat cctggagatg tgggatgggg agatctacca
      421 ctatggcttg tatgtggaac gaggcctggt gcttggcgtg cacaaaccgc cagcagctat
      481 tagcctcgct aaggtcgaac ttacaccact ctctttgttt tggagacctg tctacactcc
      541 ccagtacctc atctccccag acacccttag gagattgcat ggtgaatcgt tcccttacac
      601 agcctttgac aacaactgtt atgccttctg ttgctgggtt ttggacctga acgactcatg
      661 gctgagtagg aggatgatac agaggacaac tggcttcttc agaccttacc aggattggaa
      721 caggaagccc cttcccacca tggatgattc caaattaaag aaagtggcca acatattcct
      781 gtgtgcttta tcttcactat tcactagacc tatcaaggac ataataggaa agctaaaacc
      841 ccttaacatt ctcaatattt tagcttcatg tgattggacc tttgcaggca tagtggaatc
      901 tctaatcctc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactgggtg actacgaact gcaggggcct gaggacctcg cagtagagct
     1021 agtgccagta gtgatggggg gaataggttt ggtgctagga tttaccaaag aaaagattgg
     1081 gaagatgttg tcatctgccg catccacact gagggcctgt aaagaccttg gtgcatatgg
     1141 gctggagatc ttaaaactag tcatgaagtg gttcttcccg aagaaagagg aggcgagtga
     1201 gttggccatg gtgagatcca tcgaggacgc ggtgttggac ctcgaagcaa ttgaaaacaa
     1261 ccatttgacc accctgctta aggacaagga cagcctggca acttacatga gaactcttga
     1321 ccttgaggaa gagaaagcca ggaaactctc aaccaagtct gcctcacctg acatcgtggg
     1381 tacaatcaat gccctcctgg cgaggatcgc ggctgcccgt tccctggtac atcgagcaaa
     1441 ggaagaactt tccagcaggc cgagacccgt tgtcgtgatg atatcaggaa aaccaggaat
     1501 agggaagacc caccttgcca gagagctggc taagaagatc gcaaccaccc ttacgggaga
     1561 ccagagggtg ggcctcatcc cacgcaatgg tgttgaccac tgggacgcgt acaagggaga
     1621 gagggtcgtc ctttgggatg actacggtat gagtaatccc atccacgatg ccctcaggtt
     1681 gcaggagctt gctgacactt gccccctaac actaaattgt gacaggattg agaacaaagg
     1741 taaagttttt gacagtgatg ctataattat caccactaac ttggccaacc cagcaccact
     1801 ggactatgtc aactttgagg cgtgctcgag gcgcattgat ttcctcgtgt acgccgaagc
     1861 ccctgatgtt gagaaggcga agcgcgactt cccaggccaa cctgatatgt ggaagaatgc
     1921 cttcagccct gacttctctc acataaagct gatgctggcc ccgcagggtg gctttgacaa
     1981 gaacggcaat accccacatg ggaagggtgt catgaagacc ctcaccatcg gttctctcat
     2041 cgcccgtgct tcaggactcc tccatgaaag gctggatgag tacgagttgc aaggcccagc
     2101 cctcacaacc ttcaactttg accgaaacaa agtgctcgct ttcagacagc ttgctgctga
     2161 aaacaagtac gggttgatgg atacgatgag agttggaggg caactcaagg gcgtcagaac
     2221 catgccagag ctcaagcaag cactcaagaa catctcaatt aagaggtgcc agatagtgta
     2281 tggtggcagc acctacacac ttgaatctga tggcaagggt agtgtgaggg ttgacagggt
     2341 tcagagtgcc actgtgcaaa ccaacaacga actagccggc gccctgcatc atctcaggtg
     2401 cgccaggatc aggtactatg tcaagtgtgt ccaggaagct ctgtactcca tcattcaaat
     2461 tgcaggggct gcgtttgtca ccacgcgcat tgtcaagcgc atgaacatac aggatctatg
     2521 gtccaagcca caactggagg acacggaaga agccactggc aaagacggat gcccaaaacc
     2581 caaagatgat gaggagtttg ttgtctcatc cgacgacatc aaggttgagg gcaagaaagg
     2641 gaagaacaag actggtcgcg gcaagaagca cacagccttc tcgagtaaag gtctcagtga
     2701 tgaggagtac gacgagtaca aaagaatcag ggaggaaaga aacggcaagt attctataga
     2761 ggagtacctc caagacagag acaagtatta tgaggaggtt gccatcgcca gggcgactga
     2821 agaggatttc tgtgaagagg aagaggccaa gatccgacag agaatcttta gaccaacaag
     2881 gaaacaacgc aaggaggaga gggcttctct cggtctagtc acaggctctg agatcaggaa
     2941 aagaaaccca gatgacttca aacccaaggg aaagttgtgg gccgatgacg acagaagtgt
     3001 cgattacaac gagaagctca gttttgaagc cccaccaagc atctggtcaa ggatagtcaa
     3061 ctttggttcg ggttggggtt tctgggtttc ccccagtctg ttcataacat caactcatgt
     3121 tataccccag ggcacacagg agttcttcgg agtgtccatc aagcaaatcc agatacacaa
     3181 atcaggcgaa ttctgccgcc tgaggttccc aaaaccaatc aggaccgatg tgacaggcat
     3241 gatcttagag gagggtgccc ccgaaggcac cgtggccaca ctactcatca agagaccaac
     3301 tggtgaactc atgcctttag cagccaggat gggcactcat gcaaccatga agatccaagg
     3361 tcgcactgtt ggaggccaaa tgggtatgct cctgacaggg tccaatgcca agagtatgga
     3421 cctgggcacc acacctggcg actgtggttg tccctacatt tacaagagag ggaacgacta
     3481 cgtggtcatc ggggttcaca cggctgctgc ccgaggaggg aacactgtca tatgtgccac
     3541 ccagggaagt gaaggtgagg ccacacttga gggcggtgat aacaaaggca cctactgtgg
     3601 cgctccgatc ctaggtccag gaagtgcccc aaagctcagc accaaaacca aattctggag
     3661 atcatccaca gcaccactcc cacctggcac ctatgaacca gcctacctcg gtggtaagga
     3721 ccccagaatc aagggtggcc cctcactaca acaagttatg agggaccagt tgaaaccatt
     3781 cacggaacca agaggcaaac aaccaaagcc aagtgtgttg gaagctgcca agagaaccat
     3841 tattaacgtc ctcgaacaaa caatagaccc acctcagaaa tggacgtttg cgcaagcttg
     3901 cgcgtctctt gacaagacca cctccagtgg tcatccacac cacatacgga agaatgaatg
     3961 ctggaatgga gattccttca caggcaagtt ggcagatcag gcctcaaagg ccaacttgat
     4021 gtttgaggag gggaagaaca tgaccccagt ttacacaggt gccctcaagg atgagttggt
     4081 caaaactgac aagatatatg gcaagattaa gaagagacta ctttggggat cggacctggc
     4141 aaccatgatc cggtgtgccc gggcgttcgg gggcctaatg gatgagctca aggcccactg
     4201 tgtcacactt cctgtcagag ttggtatgaa catgaatgag gatggcccca tcatctttga
     4261 aaagcattcc aggtatagat atcactatga tgcagactat tctagatggg actcaacgca
     4321 acaaagagct atattggctg cagccctaga gatcatggtc aaattctccc cagagccaca
     4381 cttagcccag atagttgcag aagaccttct atcccccagc gtgatggacg tgggtgattt
     4441 caagatttca atcaacgagg gcctcccctc tggggtgcct tgcacttcac aatggaattc
     4501 tattgcccac tggctcctca ccctctgtgc tctctctgaa gtcacggatc tctcccctga
     4561 catcgttcag gccaattctc tcttctcttt ctatggtgat gatgaaattg tgagcacaga
     4621 tataaaattg gacccagaaa aactgacggc aaagctaaag gaatacggac tgaagccaac
     4681 ccgccctgac aagactgaag gacctctaat catttctgag gatctaaatg gtttgacctt
     4741 cctgcgaagg actgtaaccc gtgatccagc tggttggttt ggtaaattgg aacaaagctc
     4801 aatactcagg cagatgtact ggaccagggg ccccaaccat gaggacccat ctgaaacaat
     4861 gataccacat tcccaaaggc ccacgcagtt gatgtctttg ctgggtgagg ctgcactgca
     4921 cggcccagca ttctacagca agatcagtaa actagtcatc acagagttaa aggaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc gatgttcagg tggatgagat tctcagacct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcctgtt gttggtgctg ccattgcagc acctgtggca ggccaacaaa
     5221 atataattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagttcacag
     5281 tgtcccctag aaacgctcca ggtgagatac tatggagcgc gcccttgggc cctgatttga
     5341 acccctatct ttctcacctg tccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aagtgatcct cgcagggaac gcgttcaccg ccgggaaagt catatttgca gcagttccac
     5461 caaattttcc aactgaaggt ctaagcccca gccaggttac tatgttcccc catataattg
     5521 tagatgttag gcaattggaa cctgtattga tccccctacc tgatgttagg aataatttct
     5581 atcattataa tcaagcacat gattctactc tcaaattgat agcaatgttg tacacaccac
     5641 tcagagctaa taatgccggg gatgatgtct ttacagtctc ttgtcgagtc ctcacgagac
     5701 catcccccga ttttgatttt atattcctgg tgccacccac agttgaatca agaactaaac
     5761 catttactgt cccaatctta actgttgagg aaatgtccaa ttcaagattc cccattcctt
     5821 tggaaaagct gtacacgggt cctagcagtg cttttgttgt ccaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ttaggcacta ctcagctgtc agctgtcaat atctgcaact
     5941 tcagggggga tgtcacccgt gttgggatca gccatgatta tacaatgaat ttggtgtccc
     6001 aaaattggaa taattatgat ccaacagaag aaattccagc tcccctggga acaccagact
     6061 ttgtaggaaa gatccaaggt ttgctcaccc aaaccacaag agcggacggc tcgacccgcg
     6121 cccacaaagc tacagtgagc actgggagtg tccacttcac tccaaagctg ggtagtgttc
     6181 aattcaccac cgatacgaac aatgatttcc aaactggcca aaacacaaaa tttaccccag
     6241 ttggtgtcat ccaagacggt gatcaccatc agaatgaacc ccaacaatgg gtactcccaa
     6301 attactcagg cacatctggt cacaatgtgc atctggcccc tgccgttgcc cccactttcc
     6361 cgggtgagca gcttcttttc tttaggtcca ctatgcccgg gtgtagcggg taccccaaca
     6421 tgaatttgga ttgcctactc ccccaggagt gggtgctgca cttttaccag gaagcagccc
     6481 cagcacaatc cgatgtggcc ctgctgagat ttgtgaatcc agacacaggt agggttctgt
     6541 ttgagtgcaa actccataag tcaggctata tcacagtggc tcatactggc ccgtatgatt
     6601 tggttatccc ccccaatggt tacttcagat ttgattcttg ggtcaaccag ttctacacac
     6661 tcgcccccat gggaaatgga acggggcgca ggcgtgcttt ataatggctg gacctttctt
     6721 tgctggattg gcatctgatg tcctcggttc tggacttggt tctctaatca atgctggagc
     6781 tggagccatc aatcaaaaag ttgaatttga aaataataga aaattgcaac aagcttcttt
     6841 tcaattcagt agtaatctgc aacaggcttc cttccaacat gataaggaga tgctccaagc
     6901 acaaattgag gctactcaaa aattgcaaca aggtttgatg aaggttaaac aggcagtgct
     6961 cctagagggt gggttttcca caacagatgc ggcccgtggg gcaatcaacg cccccatgac
     7021 aaaggctctg gactggagcg gaacaaggta ctgggcccct gatgccaggg ccacaacata
     7081 caatgcaggc cgcttctcca cccctcagcc tttgggggca ttacctggaa gaatcaatcc
     7141 tagggttcct gcacctgctc ggagctcccc cagttcactt tccaatgctc ctactgctac
     7201 ttctgtgtat tccaatcaaa ctgtttctac gagactaggt tcttcagctg gttctggtgc
     7261 cggtgtctcg agtctcccgt caactgcaag gactaggagc tgggttgagg accaaaacag
     7321 aaatttgtcg cctttcatga ggggggctct caacacatca tttgtcaccc ctccatctag
     7381 tagatcctcc aaccaaggca cagtctcaac cgtgcctaaa gagattttgg actcctggac
     7441 tggcgctttt aacacgcgca ggcagcctct cttcgcacac attcgtaagc gaggggagtc
     7501 acgggtgtaa tgtgaaaaga caaattgatt atctttctct tctttaatg
//