Typing tool

Complete norovirus genomes

JQ613568  GII.12
 GII.P33

Length: 7,523 | 3 CDS

ORF1: 5..5110
ORF2: 5091..6698
ORF3: 6698..7477
LOCUS       JQ613568                7523 bp    RNA     linear   VRL 30-APR-2014
DEFINITION  Norovirus Hu/GII.g-GII.12/Wahroonga/NSW004P/2009/AU, complete
            genome.
ACCESSION   JQ613568
VERSION     JQ613568.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.g-GII.12/Wahroonga/NSW004P/2009/AU
  ORGANISM  Norovirus Hu/GII.g-GII.12/Wahroonga/NSW004P/2009/AU
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7523)
  AUTHORS   Eden,J.S., Hewitt,J., Lim,K.L., Boni,M.F., Merif,J., Greening,G.,
            Ratcliff,R.M., Holmes,E.C., Tanaka,M.M., Rawlinson,W.D. and
            White,P.A.
  TITLE     The emergence and evolution of the novel epidemic norovirus GII.4
            variant Sydney 2012
  JOURNAL   Virology 450-451, 106-113 (2014)
   PUBMED   24503072
REFERENCE   2  (bases 1 to 7523)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2012) School of Biotechnology and Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
FEATURES             Location/Qualifiers
     source          1..7523
                     /organism="Norovirus
                     Hu/GII.g-GII.12/Wahroonga/NSW004P/2009/AU"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.g-GII.12/Wahroonga/NSW004P/2009/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:1183320"
                     /country="Australia"
                     /collection_date="May-2009"
                     /note="genotype: GII.g-GII.12"
     5'UTR           1..4
     CDS             5..5110
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AFJ21381.1"
                     /translation="MKMASNDASAAAAAISNNDIAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPRETTQKQKPPRPPTPELIKKIPPPPPNGEDDIVVSYSAKEGVSGLPELSTVRQ
                     PDETNTAFSVPPLNQRENRDAKEPLPGTILEMWDGEIYHYGLYVERGLVLGVHKPPSA
                     ISLAKVELTPLSLYWRPVYTPQYLISPETLKKLHGETFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIVLCALSSLFTRPIKDII
                     GKLRPLNILNILASCDWTFAGVVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKDEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDLEEEKARKL
                     STKSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLAR
                     DLAKKVAATLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELAD
                     TCPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPDV
                     EKAKRDFPGQPDMWKDAFRPDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTSGSLVA
                     RASGLLHERLDEYELQGPTPTTFNFDQNKVFAFRQLAAENKYGLMDTMRVGSQLKNVK
                     TVSELKQALKNIAIRRCQIVYSGLTYSLESDGKGNVRVEKVQSPAVQTNNELTGALHH
                     LRCARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSRPQVEDEEETTSKD
                     GCPKPKDEEEFVISSEDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREER
                     NGKYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLG
                     LVTGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWV
                     SPSLFVTSTHVIPQGAQEFFGVSIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAP
                     EGTVATLLIKRPTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTP
                     GDCGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEAVLEGGDNKGTYCGAPI
                     LGPGNAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFT
                     EPRGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTFAQACASLDKTTSSGYPHHVRKNE
                     HWNGESFTGKLADQASKANLMFEEGKHMTPVYTGALKDELVKTDKIYGKIKKRLLWGS
                     DLATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYTYHYDADYSR
                     WDSTQQRAVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISITEGLPSGVP
                     CTSQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAK
                     LKEYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTR
                     GPNHEDPAETMIPHSQRPIQLMSLLGEAALHGPSFYSKISKLVISELKEGGMDFYVPR
                     QEPMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5091..6698
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AFJ21382.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRLNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAVPPHFPLENISPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQNEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPILTIGELTNSRFPVPIDELYTSPNESLVVQPQNGRCALDGELQGTT
                     QLLPTAICSFRGRINQKVSGENHVWNMQVTNINGTPFDPTEDVPAPLGTPDFSGKLFG
                     VLSQRDHDNACRSHDAVIATNSAKFTPKLGAIQIGTWEQDDVHINQPTKFTPVGLFES
                     EGFNQWTLPNYSGALTLNMGLAPPVAPTFPGEQILFFRSHIPLKGGVADPVIDCLLPQ
                     EWIQHLYQESAPSQTDVALIRFTNPDTGRVLFEAKLHRSGYITVANTGSRPIVVPANG
                     YFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     CDS             6698..7477
                     /note="minor structural protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AFJ21383.1"
                     /translation="MAGAFIAGLAGDIVTNGIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQIQATKQLQADMIAIRQGVLTAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRHWAPGAMKTTAFSGGFTSASHARTVDLTRKTSATPASMPVSRPSFTASTVSTRSTL
                     ISGSSNPSSLARSSSSISSQSTSSSSRTSDWVRSQNRALEPYMSGALRTAYVTPPSSR
                     ASSNGTVSTVPKEVLDSWTSVFNTHRQPLFAHLRRRGESQV"
     3'UTR           7478..7523
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gctgctatca gcaacaacga
       61 catcgcaaaa tcttcaagtg acggagtact aagtagtatg gctgtcactt ttaaacgagc
      121 cctcggggcc cggcctaaac agccgccccc gagggaaaca acacaaaaac aaaaacctcc
      181 acgaccgccc accccggagt taatcaaaaa gattccacct cccccgccca acggggagga
      241 cgatatagtg gtatcctaca gtgccaaaga gggggtctcc ggcctgcctg agctatccac
      301 cgtcaggcag ccggatgaga caaacacagc atttagtgtc cccccactca accagaggga
      361 aaacagggat gctaaagaac cgctgcctgg caccatattg gaaatgtggg acggagagat
      421 ctaccactac ggcttgtacg tggagcgggg tttggtgctt ggggtgcaca aaccaccatc
      481 ggctattagc ctcgcaaagg ttgaactaac accactgtct ctgtactgga gaccagtgta
      541 cacccctcag tacctcatat ccccggaaac actcaaaaag ctacatggag agacattccc
      601 ttacacggcc tttgataaca actgttacgc cttctgttgt tgggtcttgg atctaaacga
      661 ctcttggctc agcaggagga tgattcagag aacaactggc ttcttcagac cctaccagga
      721 ctggaacagg aaacctctcc ccactatgga tgattccaaa ttgaaaaagg tggctaatat
      781 agtcctgtgt gctttgtcat cactattcac caggcccatt aaggacataa taggaaaact
      841 aaggccctta aacatactca acatactagc ttcctgcgac tggactttcg caggagtagt
      901 ggaatcccta attctccttg cagaactctt cggagttttc tggacacccc cagatgtgtc
      961 tgcgatgatc gcccccttac taggtgacta cgaactacag ggacctgaag atctcgctgt
     1021 agaactcgta ccagtagtaa tgggggggat aggtttggtt ctaggtttca ccaaggagaa
     1081 gattggcaag atgctgtcat ccgccgcgtc cacccttaga gcttgtaaag accttggagc
     1141 atatgggtta gaaatcctga agttggtcat gaaatggttc ttcccgaaga aagacgaggc
     1201 aaatgaactt gcaatggtga gatccattga ggacgcagtg ctggacctcg aagcaattga
     1261 aaacaatcac atgaccaccc tgctcaaaga caaagacagt ttggcaacct acatgaagac
     1321 tctggatctt gaagaggaga aagctaggaa actctccacc aaatccgctt ctcctgatat
     1381 tgtgggcaca atcaattcac ttctggcacg gattgcagct gcccgttccc tggtgcaccg
     1441 ggcaaaagaa gagctttcca gtaggccaag acccgttgtt gttatgatat caggaaagcc
     1501 aggaataggg aagacccatc ttgccagaga tttggcaaag aaagttgcag ccaccctcac
     1561 aggagaccag agggtgggcc tcatcccacg gaatggtgtc gaccattggg atgcatacaa
     1621 aggtgagaga gtcgtccttt gggatgacta tggaatgagt aaccccattc atgacgccct
     1681 taggctacaa gaacttgctg acacttgccc cctaacatta aattgtgata gaattgagaa
     1741 caaaggaaag gtttttgaca gtgatgccat aattattaca actaatttgg ctaacccggc
     1801 accactggac tatgttaact ttgaagcatg ttcgaggcgt atcgacttcc ttgtgtacgc
     1861 tgatgccccc gacgttgaaa aggcaaaacg cgacttccca gggcaacctg acatgtggaa
     1921 ggatgctttt agacctgact tctcacacat aaagttaatg ttggctcctc agggtggttt
     1981 tgataagaac ggcaacaccc cacatggaaa aggtgtcatg aaaaccctca catctggctc
     2041 cctcgttgcc cgtgcttcag gactcctcca cgaaagactg gacgagtacg agttgcaagg
     2101 gccaacaccc acaaccttca atttcgacca aaacaaggtg ttcgccttta ggcagctcgc
     2161 cgctgaaaat aaatacgggc tgatggacac catgagagtg ggaagccagc tcaagaatgt
     2221 caaaactgtg tcagagctca aacaggcact caagaacatt gcaattagaa ggtgccagat
     2281 agtctacagt ggtctcacat actcacttga atctgatggc aaaggtaatg taagggttga
     2341 gaaggtgcaa agtccagctg tgcagaccaa caatgagcta actggcgcac tacaccatct
     2401 gaggtgcgct aggattagat attatgttaa gtgtgttcag gaagctttgt attccatcat
     2461 ccaaattgct ggggccgcgt ttgtcaccac gcgcattgca aagcgcatga acatacaaaa
     2521 cctctggtcc agaccacagg tggaggatga ggaagagacc accagcaaag acggatgccc
     2581 aaaaccaaag gatgaggagg agtttgtcat ctcgtctgaa gacatcaaag tcgaaggcaa
     2641 gaagggaaag aacaagtctg gccgtggcaa gaaacacaca gccttttcga gtaaaggtct
     2701 tagtgatgag gagtacgatg agtataaaag aattagagaa gaaagaaatg gtaagtactc
     2761 catagaagaa tacctccagg acagagacaa gtactatgag gaggtggcca tagccagggc
     2821 tactgaagag gacttctgtg aggaagaaga agccaagatt cgtcagagga ttttcagacc
     2881 aacaaggaaa caacgcaagg aggagagggc ttcactcgga ctggttacag gctcagaaat
     2941 caggaaaagg aacccggatg acttcaaacc caaaggaaaa ctgtgggctg atgatgacag
     3001 gagtgtcgat tacaatgaaa agcttagttt tgaggccccc ccaagcatct ggtcgagaat
     3061 agtcaacttt ggatcaggtt ggggcttctg ggtctcacca agcctttttg taacatccac
     3121 ccatgtcata cctcaagggg cacaagaatt tttcggtgtt tccatcaaac agatccaaat
     3181 tcacaagtcg ggtgaattct gccgactaag attcccaaaa ccaattagaa ctgatgtgac
     3241 aggtatgatc ctggaggagg gggcccctga agggactgtg gccacactgc tcataaagag
     3301 gccaactgga gagctgatgc cactggcagc tagaatgggc acccatgcaa ctatgaggat
     3361 ccagggtcga actgtcgggg ggcagatggg gatgctcctg acgggatcca acgccaagag
     3421 catggatttg ggtaccacac caggtgactg tggatgccca tacatataca aaagaggaaa
     3481 tgactacgta gtcatcgggg tccacacagc tgccgcccgc ggagggaaca ctgtcatctg
     3541 tgcaacacaa ggaagtgagg gcgaggctgt gcttgaaggt ggcgacaaca aaggcaccta
     3601 ttgtggcgcc ccaatcctag gtccaggaaa tgcccccaaa ctcagtacta aaaccaaatt
     3661 ctggaggtcc tcaacagcac cactcccacc tggcacatat gaaccagctt acctcggagg
     3721 caaagacccc agagtaaaag gtggcccctc attacagcaa gttatgagag accaactgaa
     3781 accatttaca gaacccagag gtaagccacc aaagcccagt gtactagaag cagccaaaaa
     3841 gacaatcatt aatgtccttg agcaaacaat agacccaccc caaaaatgga cgttcgcaca
     3901 ggcgtgcgca tccctcgaca aaacaacctc tagtggctac ccgcaccacg tgcggaagaa
     3961 tgaacattgg aatggggaat ctttcacagg aaaattggct gatcaggctt caaaagctaa
     4021 cctgatgttt gaggaaggta aacacatgac accagtctac acaggagccc tcaaggatga
     4081 gttagtcaaa actgataaaa tatatggcaa gatcaagaag aggttgctat ggggttcaga
     4141 tctggcaacc atgatccgct gcgctcgagc gttcggaggg ttaatggatg aactcaaggc
     4201 tcactgtgtc acactcccca tcagggtagg gatgaacatg aatgaggatg gccccatcat
     4261 ttttgagaaa cactctagat acacctatca ttatgatgca gactactctc ggtgggactc
     4321 aacacagcag agagctgttt tagctgcagc cctggagatc atggtaaaat tttccccaga
     4381 accacacctg gcccagatcg ttgcagagga tctcctatct cccagcgtga tggacgtggg
     4441 cgatttcaaa atatcaatca ctgaaggact cccctctggg gtgccttgca cctcacaatg
     4501 gaattctatt gctcattggc tcctcacgct ttgtgcactc tctgaggtaa cagatttgtc
     4561 tcctgacatc atccaagcaa actcactctt ctctttctat ggtgacgatg aaattgtgag
     4621 cacagacatc aaattagatc cagaaaagct gacagctaaa ctaaaagagt atggtctcaa
     4681 gccaacccgt cctgacaaga ctgaagggcc tctggtcatt tctgaggact tagatggtct
     4741 gaccttctta cggaggactg tgacccgtga cccagcaggt tggtttggaa aattggaaca
     4801 aagctcaata cttagacaga tgtattggac caggggcccc aaccatgagg atcccgctga
     4861 aacaatgata ccacactccc aaagacccat acagttgatg tccctattag gtgaagctgc
     4921 attacatggc ccatcattct acagcaaaat cagcaaattg gtcatctcag agttaaaaga
     4981 aggtggcatg gacttttacg tgccaaggca agagccaatg tttcgatgga tgaggttctc
     5041 agacttgagc acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg
     5101 cgtcgaatga cgccgctcca tctaatgatg gtgcagccgg tctcgtacca gaggtcaaca
     5161 atgagaccat ggcacttgaa ccggtggctg gggcttcaat agccgcccca ctcaccggtc
     5221 aaaataatgt tatagacccc tggattagat taaactttgt gcaagctccc aatggagagt
     5281 ttacagtttc accccgcaat tcgcctgggg aagtcctact aaacttggaa ttaggccctg
     5341 aactaaatcc atatttggca cacctttcca gaatgtacaa tggttatgca ggtggagttg
     5401 aggtgcaagt actactggct gggaacgcgt tcacggctgg aaaactggta ttcgccgcag
     5461 ttccccctca ttttccatta gaaaacataa gccctggcca aataaccatg ttccctcatg
     5521 taattattga tgttaggact ttagaaccag tcctattgcc tcttccagat gttaggaaca
     5581 atttctttca ctacaatcag caaaacgaac cgaggatgag gcttgtggca atgctctaca
     5641 ccccccttag gtctaatggt tctggtgatg atgtatttac tgtctcctgt agagtgctta
     5701 ctcgaccctc tcctgatttt gatttcaatt atttggtacc ccctacagtt gaatctaaaa
     5761 ctaaaccctt cacactcccc atcttgacca taggggagtt aaccaattcc agattccctg
     5821 tgcctataga tgaactctac actagcccca atgagagttt ggtggtacaa ccccagaacg
     5881 ggagatgcgc gctggatggg gagttgcagg gtactactca gctcctcccc acggcgatct
     5941 gctcgttcag gggtcggatt aatcagaaag tgagtggaga gaaccatgtt tggaatatgc
     6001 aagtcaccaa cattaacgga accccttttg atccaacaga ggatgttcca gctcctctag
     6061 gtacaccaga cttttctggc aagctctttg gtgtcctaag ccagagggac catgataatg
     6121 cctgtaggag ccatgatgca gtgattgcaa ctaattctgc taaatttacc ccaaaattgg
     6181 gcgctataca aattggcaca tgggaacaag atgatgtaca catcaaccaa cccaccaaat
     6241 ttactccagt tggcttgttt gaaagtgaag gttttaatca gtggacactc cctaattatt
     6301 ctggagcctt aacactcaac atggggttgg ccccccctgt ggcccccaca tttcctggcg
     6361 agcaaattct tttcttcaga tcccacattc ctcttaaagg aggtgtggca gacccagtta
     6421 ttgattgtct cttgccccaa gagtggatcc aacaccttta tcaggagtca gccccttcac
     6481 aaacagatgt agcactgatc agattcacaa atccagacac agggcgtgtc ctatttgaag
     6541 caaaattgca caggagtggc tacatcacag tggccaacac tggtagcaga ccaattgtgg
     6601 tgccagctaa tggttacttc aggtttgact cttgggttaa tcagttttat tctctcgccc
     6661 ccatgggaac tgggaatggg cgcagaaggg tgcagtaatg gctggagctt tcatagcagg
     6721 tcttgctggt gatatagtca ccaatggtat tggctcactc gtgaacgctg gggccaatgc
     6781 aataaaccaa aaagtagact ttgaaaacaa taagcaacta cagcaggcat ccttcaatca
     6841 tgacaaagag atgctgcaag ctcaaattca agccaccaaa cagctacagg ctgatatgat
     6901 tgcaatcaga caaggggtgt tgaccgcggg cggcttctcc cccactgatg cagcaagagg
     6961 tgcagtcaac gcacccatga cacaggtctt ggactggaac gggactagac attgggcccc
     7021 cggagccatg aaaacaactg ctttctccgg tgggttcacc agtgcttctc atgccaggac
     7081 cgttgacctg actaggaaaa catcagccac accagcctct atgcctgtct ctaggcccag
     7141 ttttactgcc tctactgttt ccacccgttc taccttgatt agtggatcct ctaatccttc
     7201 ttctctagct aggagttctt ccagtatttc ttcccaatct acttcctcat cctctcggac
     7261 tagtgattgg gtacgtagcc aaaacagagc actggagcct tatatgagcg gggcgctgcg
     7321 tacagcctac gtgacacctc catccagtag ggcttctagc aatggcacag tctcaaccgt
     7381 gccaaaagag gttttggact cctggacatc tgtattcaac acacacagac aaccgctgtt
     7441 tgctcatctc cgtcggagag gggagtcaca agtttagtga aaagatggtc ttttctttta
     7501 ttcctttgaa atctctgtct ttt
//