Typing tool

Complete norovirus genomes

JQ388274  GI.6
 GI.P11

Length: 7,691 | 3 CDS

ORF1: 5..5371
ORF2: 5355..6977
ORF3: 6977..7606
LOCUS       JQ388274                7691 bp    RNA     linear   VRL 22-APR-2012
DEFINITION  Norovirus Hu/GI.6/Kingston/ACT160D/2010/AU, complete genome.
ACCESSION   JQ388274
VERSION     JQ388274.1
KEYWORDS    .
SOURCE      Norovirus Hu/GI.6/Kingston/ACT160D/2010/AU
  ORGANISM  Norovirus Hu/GI.6/Kingston/ACT160D/2010/AU
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7691)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Norovirus Full-Length Genomes
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7691)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-JAN-2012) School of Biotechnology and Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
FEATURES             Location/Qualifiers
     source          1..7691
                     /organism="Norovirus Hu/GI.6/Kingston/ACT160D/2010/AU"
                     /mol_type="genomic RNA"
                     /strain="Hu/GI.6/Kingston/ACT160D/2010/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:1173217"
                     /country="Australia"
                     /collection_date="2010"
                     /note="genotype: GI.6"
     5'UTR           1..4
     CDS             5..5371
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AFH88382.1"
                     /translation="MMMASKDVVATNVASNNNANNTSATSRFLSRFRGLGGGASPPNP
                     IKIKSTEMALGLIGKTTQEAAGTNGLPPKQQRDRPPRTQEEVQYGMGWTERPMDQNVK
                     SWEELDTSTKEEILDSHKEWFDAGGLGPCTMPSTCEQARDDSPPGEQVRWSVRDGIDL
                     GVNRLTTVSGPEWNLCPLPPIDLRNMEPASEPTIGDMIEFYEGHIYHYSIYIGQGKTV
                     GVHSPQAAFSVARVTIQPIAAWWRVCYIPQPKHRLSYDQLKELENEPWPYAAITNNCF
                     EFCCQVMNLEDTWLQRRLITSGRFHHPSQSWSQQTPEFQQDSKLELVRDAILAAVNGL
                     VSQPFKNFLNKLKPLNILSILSNCDWTFMGVVEMVVLLLELFGVFWNPPDVSNFIASL
                     LPDFHLQGPEDLARDLVPVILGGIGLAIGFTRDKVTKVMKSAVDGLRAATQLGQYGLE
                     IFSLLKKYFFGGDQTERTLKGIETAVIDMEVLSSTSVTQLVRDKQAAKAYMNILDNEE
                     EKARKLSAKNADPHVISSTNALISRIAMARSALAKAQAEMTSRMRPVVIMMCGPPGIG
                     KTKAAEHLAKRLANEIRPGGKVGLVPREAVDHWDGYHGEEVMLWDDYGMTKIQDDCNK
                     LQAIADSAPLTLNCDRIENKGMQFVSDAIVITTNAPGPAPVDFVNLGPVCRRVDFLVY
                     CSAPEVEQIRRVSPGDTSALKDCFKPDFSHLRMELAPQGGFDNQGNTPFGKGIMKPTT
                     INRLLIQAVALTMERQDEFRLQGKMYDFDDDRVSAFTTMARDNGLGILSMASLGKKLR
                     GVTSMEGLKNALKGYKIGACTIKWQAKVYSLESDGNSVNIREEKNVLTQQQQSVCTAS
                     IALTRLRAARAVAYASCIQSAITSILQIAASALVVNRAVKRMFGTRTAALSLEGPPKE
                     HKCRVHQAKAAGKGPIGHDDVVDKYGLCETEEDEEAVQTEMPSATIEGKNKGKNKKGR
                     GRKNNYNAFSRRGLNDEEYEEYKKIREEKGGNYSIQEYLEDRQRYEEELAEVQAGGDG
                     GIGETEMEIRHRVFYKSKSKKHHQEERRQLGLVTGSDIRKRKPIDWTPPKSAWADDER
                     EVDYNERINFEAPPTLWSRVTKFGSGWGFWVSPTVFITTTHVIPTSAKEFFGEPLTSI
                     AIHRAGEFTLFRFSKKIRPDLTGMILEEGCPEGTVCSVLIKRDSGELLPLAVRMGAIA
                     SMRIQGRLVHGQSGMLLTGANAKGMDLGTIPGDCGAPYVYKRANDWVVCGVHAAATKS
                     GNTVVCAVQASEGETTLEGGDKGHYAGHEIIKHGCGPALSTKTKFWKSSPEPLPPGVY
                     EPAYLGGRDPRVSGGPSLQQVLRDQLKPFAEPRGRMPEPGLLEAAVETVTSSLEQVMD
                     TPVPWSYSDACQSLDKTTSSGFPHHKKKNDDWNGTAFIRELGEQAAHANNMYEQGKSM
                     KPMYTAALKDELVKPEKVYQKVKKRLLWGADLGTVIRAARAFGPFCDAIKSHTIKLPI
                     KVGMNSIEDGPLIYAEHSKYKYHFDADYTAWDSTQNRQIMTESFSIMCRLTASPELAS
                     VVAQDLLAPSEMDVGDYVIRVKEGLPSGFPCTSQVNSINHWLITLCALSEVTGLSPDV
                     IQSMSYFSFYGDDEIVSTDIEFDPAKLTQVLKEYGLKPTRPDKSEGPIIVRKSVDGLV
                     FLRRTISRDAAGFQGRLDRASIERQIYWTRGPNHSDPFETLVPHQQRKIQLISLLGEA
                     SLHGEKFYRKISSKVIQEVKTGGLEMYVPGWQAMFRWMRFHDLGLWTGDRNLLPEFVN
                     DDGV"
     CDS             5355..6977
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="AFH88383.1"
                     /translation="MMMASKDAPTSPDGASGAGQLVPEANTAEQISMDPVAGASTAVA
                     TAGQVNMIDPWIFNNFVQAPQGEFTISPNNTPGDILFDLQLGPHLNPFLAHLSQMYNG
                     WVGNMRVRILLAGNAFTAGKIIICCVPPGFDARILTIAQATLFPHLIADVRTLEPVEL
                     PLEDVRNVLYHNSSQPQPTMRLVAMLYTPLRTGGGSGGTDAFVVAGRVLTCPAPDFSF
                     LFLVPPSVEQKTRVFSVPNIPLKDLSNSRVPVPVQGMFMSPDVNQSVQFQNGRCQIDG
                     QLQGTTPVSLSQLCKIRGKTSSNARVLNLSEVDGTPFIPLESPAPVGFPDLGGCDWHV
                     NFTFQAQNQDPSQSVTFATNDASFVPYLGSISPHNGGDFHAGDIIGSLGWISAPSDNS
                     QLNVWTIPKYGSSLPDVTHLAPAVFPPGFGEVILYFYSTFPGSGQPSQLQVPCLLPQE
                     FITHFCNEQAPIAGEAALLHYVDPDTGRNLGEFKLYPDGFMTCVPNSVSSGPQTLPIN
                     GVFVFVSWVSRFYQLKPVGTASAARRLGLRRI"
     CDS             6977..7606
                     /note="minor capsid protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="AFH88384.1"
                     /translation="MAQAVIGAIAASAAGSILGAGIQAGAEAGLQAQRYQQDLQLQQN
                     SFKHDKEMLGYQVQASNALLAKNLNTRYALLQAGGLSSADAARAVAGAPVTRIVDWNG
                     TRIAAPASSATTLRSGGFMAVPIPLSSKTKQPVMSGQDNPNYAASSISRTASWVQSQN
                     SMRSVSPFHSDALRTVWVTPPGSSSTSSVQSSFYGVFNTDRLPLFANRR"
     3'UTR           7607..7691
ORIGIN      
        1 gtgaatgatg atggcgtcga aagacgtcgt tgcgactaat gttgcaagca ataacaatgc
       61 taacaacact agtgctacat ctcgattttt atcgaggttt aggggtttag gtggtggcgc
      121 gagcccccct aaccccataa agattaaaag cacagaaatg gcattgggtt tgattggcaa
      181 gacaacccaa gaggcagcag ggaccaatgg cctgccacct aaacagcaaa gagaccgacc
      241 ccccaggact caagaggaag ttcaatacgg catgggatgg actgaacggc ctatggatca
      301 gaatgttaag tcatgggagg aacttgacac ctctaccaag gaagagatct tggacagcca
      361 caaagaatgg ttcgatgcag gcggtttggg cccatgcaca atgccctcaa cttgtgaaca
      421 ggctagagat gatagcccgc ctggtgagca agtcagatgg tcagtgcgtg atggaattga
      481 ccttggagtg aatcgcctca caacggtgag tggccccgag tggaatctct gtcctttacc
      541 ccccattgac ctaaggaata tggaaccagc tagtgaaccc accattggag acatgataga
      601 gttttatgaa ggtcacatct accactactc catatacata gggcagggaa agacagttgg
      661 tgtgcactcc ccacaggcgg cattctcagt ggccagagta accatccaac ccatagctgc
      721 ttggtggagg gtctgctaca taccccagcc caaacacagg ctgagttacg accagcttaa
      781 ggagttggaa aatgaacctt ggccatatgc agctatcacc aacaattgtt ttgagttttg
      841 ctgtcaagtt atgaatcttg aggacacatg gttacagagg cgactaataa catcaggtag
      901 attccaccac ccttcccagt cttggtcaca acagacccct gaatttcagc aggacagcaa
      961 gctggagctg gttagagatg ccatactggc cgcggtgaat ggccttgttt cacaaccctt
     1021 taaaaatttc ttgaataagc tcaagcccct taacatccta agcatcttat ctaactgtga
     1081 ttggactttt atgggggtgg ttgagatggt tgtactactt cttgagctct ttggcgtgtt
     1141 ctggaatccg cccgatgtgt ctaattttat agcatctctc ctccctgatt ttcacctcca
     1201 ggggccagaa gacctagccc gggatctggt gccagtcatt cttggtggca tagggctagc
     1261 cattggattt accagagaca aggtcactaa agtcatgaaa agtgctgtag atgggctccg
     1321 ggccgctacg cagctagggc aatatggatt ggaaatattt tcactcctca agaagtattt
     1381 ctttggtggg gaccagactg aacgaactct caaaggcatt gaaacagcag tcatagatat
     1441 ggaggttttg tcctctacat cagtaacaca actggtgaga gacaagcagg cagctaaagc
     1501 ttatatgaac atcctggata atgaagagga aaaagctaga aaactctctg ctaagaatgc
     1561 tgacccccat gtgatatcct caacaaatgc cctgatatca cgcatagcca tggcacgatc
     1621 cgctctggct aaggctcaag ctgagatgac cagtcgaatg aggccagtcg ttatcatgat
     1681 gtgtggacct cctggaattg ggaagactaa ggcagcggag cacttggcaa aacgcctggc
     1741 taatgagatc aggcctggcg gcaaagtggg actagtgcca cgtgaggctg ttgaccactg
     1801 ggatggttac catggtgagg aggtgatgct atgggatgac tatggcatga caaagataca
     1861 agatgactgt aacaagctcc aggccattgc tgactctgcc ccactcactc tcaattgtga
     1921 taggattgaa aacaagggga tgcagtttgt gtcagatgcg atagtcatca ctaccaatgc
     1981 cccaggacct gcccctgtcg acttcgtcaa tctcggtcct gtgtgcagac gggttgactt
     2041 cctggtctac tgttctgccc cagaggtgga gcaaataagg agagtcagcc ctggtgacac
     2101 atcagcgctt aaagactgct tcaaaccaga tttctcccat cttaggatgg agttggctcc
     2161 tcaaggggga tttgacaacc aagggaacac gccatttggc aagggtatta tgaaaccaac
     2221 aactatcaat aggctcctca tacaagctgt ggctcttacc atggagagac aggatgagtt
     2281 ccggctccag gggaagatgt atgattttga tgatgatagg gtgtcagcct tcaccaccat
     2341 ggcacgcgat aatgggttgg gcattctgag tatggcgagc ctaggtaaga agctgcgcgg
     2401 tgttacatca atggagggtc tgaagaatgc tttgaagggg tacaaaattg gtgcgtgcac
     2461 aatcaagtgg caggccaagg tgtattcact ggaatcagat ggcaacagtg ttaacattag
     2521 agaggagaag aatgttttga ctcaacaaca gcagtcggtg tgcactgcct ccattgcact
     2581 cacccgcctg cgggccgcgc gtgcagtggc gtatgcgtca tgcatccaat cagccataac
     2641 ctccatacta caaatagctg cctcagccct agtggtcaac agagccgtga aaagaatgtt
     2701 tggcacacgc acagctgctt tatccctaga gggccccccc aaagaacaca agtgcagggt
     2761 ccaccaggct aaggccgcag ggaaggggcc cattggccat gatgacgtgg ttgataagta
     2821 tggactatgt gagactgagg aggacgaaga ggcagtccaa accgagatgc catctgccac
     2881 catagaaggc aagaataaag ggaagaacaa gaaagggcgc ggccgaaaga ataactacaa
     2941 tgccttttcc cgtagagggc tcaatgatga agagtacgag gagtacaaga aaatacggga
     3001 agagaagggt ggaaattaca gcattcagga gtacctagaa gatagacaaa ggtatgaaga
     3061 ggagcttgct gaggttcaag caggtggaga tggagggatc ggcgaaaccg aaatggaaat
     3121 ccgccataga gtgttctata agtccaagag caagaagcac caccaggaag aacggcgcca
     3181 actaggatta gtcacaggtt ctgacatccg gaaaaggaaa ccaattgact ggaccccccc
     3241 taagtcagca tgggcagatg atgagcgtga agtggactac aatgagagaa tcaactttga
     3301 ggcgcccccc actttgtgga gccgggtcac aaaatttgga tctgggtggg gcttttgggt
     3361 tagtcccaca gtcttcataa ccacaacgca cgtcatacca accagtgcaa aagagttctt
     3421 tggtgaaccc cttaccagta tagccattca tagggctgga gaattcaccc tcttcaggtt
     3481 ctctaagaaa atcaggcccg atctcacggg catgattctt gaggaaggct gcccagaagg
     3541 cacggtgtgc tcagtgttaa taaaaaggga ctccggtgag ctattaccat tagctgtaag
     3601 aatgggcgcg atagcatcaa tgcgcataca gggtcgcctt gtccatggcc agtctggtat
     3661 gttgctcacc ggggcgaatg ctaagggcat ggaccttgga actatcccag gggattgtgg
     3721 agctccctat gtctataaga gagcaaatga ctgggtggtt tgtggtgtgc atgctgctgc
     3781 cactaaatca ggcaacacgg tagtgtgtgc cgtccaagct agtgaaggag agaccacact
     3841 ggaagggggt gacaaaggtc actatgccgg gcatgagata atcaagcatg gatgtgggcc
     3901 agccctatca accaaaacaa agttctggaa gtcgtcccct gaaccactac cccctggagt
     3961 ctatgaacct gcatacctcg gtggccggga cccaagagtg agtggtggtc cctcgctcca
     4021 acaggtgttg cgggatcagt taaagccatt tgctgaacca cgggggcgta tgccagagcc
     4081 aggtctcctg gaggccgcag ttgagactgt gacctcatca ctggagcagg ttatggatac
     4141 cccagtgcca tggagttaca gcgatgcatg tcaatcccta gataaaacta ctagctcagg
     4201 tttccctcac cacaagaaga agaatgatga ttggaacggc accgccttta tcagggaatt
     4261 gggagagcaa gcggcgcacg ccaataacat gtatgaacaa ggtaagagta tgaagcccat
     4321 gtacacggcg gcgcttaagg atgaattggt gaagccagaa aaagtgtacc aaaaagtgaa
     4381 aaagcgcttg ctttgggggg cagatctagg aacagtgatc cgggctgcac gagccttcgg
     4441 cccgttctgt gacgccataa agtcccacac aatcaaatta cctatcaaag ttgggatgaa
     4501 ttcaattgag gatgggccac taatttatgc agagcattca aaatataaat atcattttga
     4561 tgcagactat acagcttggg attcaacaca aaataggcaa attatgactg aatcattctc
     4621 aatcatgtgc cgattgactg cttctccaga attggcctca gtggtagcac aagatctact
     4681 cgcaccctca gaaatggacg ttggtgacta cgtcataaga gtaaaggaag gccttccatc
     4741 cggctttcca tgcacatcac aggtcaatag cataaaccat tggttgataa ctttgtgtgc
     4801 cctctctgag gtgactggcc tgtcaccaga tgttattcag tctatgtcat acttctcttt
     4861 ctatggtgat gatgaaattg tttccactga catagaattt gacccagcta agttgacaca
     4921 agtccttaag gagtatggcc ttaagcccac ccgtcccgac aagagtgaag gtccaataat
     4981 tgtgaggaag agtgtggatg gcctagtctt cttacgccgc accatttccc gcgacgccgc
     5041 ggggttccaa gggcgactag accgggcgtc cattgaaagg caaatctatt ggaccagagg
     5101 gcccaatcac tcagacccct ttgaaacctt ggtgccccac cagcaaagaa aaattcagct
     5161 gatatcactg ttaggtgagg cttcattgca tggtgaaaag ttctacagga agatttcaag
     5221 caaagtcatc caagaggtta aaacaggggg tcttgaaatg tatgtgccag ggtggcaagc
     5281 catgttccgc tggatgcggt tccatgatct tggcttgtgg acaggagatc gcaatctcct
     5341 gcccgaattc gtaaatgatg atggcgtcta aggacgcccc aacatcccct gatggcgcca
     5401 gtggcgccgg ccagctggta ccggaggcta atacagctga gcaaatttca atggaccctg
     5461 ttgcgggtgc ttcaacagca gtcgcgacgg ctggacaagt aaatatgatt gacccttgga
     5521 tttttaataa ttttgtccag gcacctcaag gagaattcac tatttcccct aataataccc
     5581 ccggtgatat tttgtttgat ttacaattgg gaccccacct taacccattt ctagcccatc
     5641 tctcacagat gtataatggt tgggtcggca atatgcgtgt gcgcatactg ttggccggga
     5701 atgcctttac agctggaaag ataatcattt gctgtgtccc ccctggtttt gatgctagaa
     5761 tactcactat agctcaagca accctcttcc cacacttaat tgctgatgta aggacccttg
     5821 agcctgtgga gcttcctttg gaggatgtgc gcaacgttct ctaccacaat agtagccagc
     5881 cgcagccaac aatgcggctg gttgctatgt tgtacactcc cctccgcact ggtggtggtt
     5941 ccggaggcac tgatgccttt gtggtggcgg gtagggtgct tacgtgcccc gcccccgatt
     6001 ttagttttct gtttcttgtt cccccttccg ttgaacagaa gactagagtt ttcagtgtcc
     6061 ccaatatacc ccttaaagat ctctcaaatt ctcgtgtccc tgtgcccgta cagggcatgt
     6121 ttatgtcccc agatgttaat cagtcagtcc agtttcagaa tgggcgttgc caaattgatg
     6181 gtcaactcca gggcaccacc ccagtctcgc tcagccaact ctgcaagatt aggggtaaaa
     6241 cttctagcaa tgctagggtg ctcaacttaa gtgaggtgga tggcacacct tttatccccc
     6301 ttgagtcacc agcgccagtc ggttttcccg acttgggagg ttgtgactgg catgtaaatt
     6361 tcactttcca ggcccaaaat caggacccat cccaaagtgt gacctttgca actaatgatg
     6421 ctagctttgt cccttaccta ggtagcattt cccctcacaa tgggggggat tttcatgcag
     6481 gtgacatcat aggtagcctt ggatggattt cagctccgtc tgacaactca caacttaatg
     6541 tttggacaat accaaagtat ggatctagtc tcccagatgt cacccacctt gctcctgctg
     6601 tgttcccccc aggctttggg gaagtgatcc tatacttcta ttctaccttc ccaggttctg
     6661 ggcaacctag tcaacttcaa gtcccatgtt tgttacccca ggagttcatc actcacttct
     6721 gtaatgaaca agctcccatt gctggggagg ctgccctcct ccactacgtg gaccctgata
     6781 cgggccggaa cttgggggag ttcaaacttt accctgatgg atttatgacc tgtgtcccta
     6841 atagtgttag tagtggccct caaaccctac ctatcaatgg agtctttgtc tttgtttcat
     6901 gggtgtccag attctatcaa ctcaagcctg tgggaacggc ctcagcggct agaaggcttg
     6961 gactgcggcg catataatgg ctcaagctgt catcggtgcc atagccgcgt ctgccgctgg
     7021 tagcatacta ggggcaggta tacaggctgg tgctgaggct ggtctccagg ctcaacggta
     7081 ccagcaggac ctacagttgc aacaaaattc ttttaagcat gataaggaaa tgttaggcta
     7141 tcaagtacag gctagtaatg ctcttttagc taagaatctt aacactaggt atgctctcct
     7201 gcaggcagga ggcctgtcta gtgctgatgc tgcccgggca gtggccggcg cccctgtcac
     7261 ccgtatagtg gattggaatg gcacgcgcat tgcagcgccc gcctcaagtg ccaccacact
     7321 tagatctggt ggttttatgg ctgtccctat accattgtct tcaaagacca agcaaccagt
     7381 gatgtctggg caggacaatc caaattatgc tgcttcttct atctctagaa ctgcttcatg
     7441 ggtgcaatct caaaattcta tgaggtctgt ctctcctttt cacagtgatg ctctgagaac
     7501 cgtttgggtt acgccacccg gttcatcatc aacctcatct gtgcagtcta gtttttatgg
     7561 tgtttttaat acagatagat tgcctctgtt cgcaaacaga aggtaaaatt ttgtaatagg
     7621 atgccagtgg gcaccatatt cagatttggt ttaattagat tgttttaatc aaatttggct
     7681 taattggtgt t
//