Typing tool

Complete norovirus genomes

JN400599  GII.4 Hunter
 GII.P4 Hunter

Length: 7,509 | 3 CDS

ORF1: 1..5100
ORF2: 5081..6703
ORF3: 6703..7509
LOCUS       JN400599                7509 bp    RNA     linear   VRL 19-DEC-2013
DEFINITION  Norovirus Hu/GII-4/CGMH01/2006/TW, complete genome.
ACCESSION   JN400599
VERSION     JN400599.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII-4/CGMH01/2006/TW
  ORGANISM  Norovirus Hu/GII-4/CGMH01/2006/TW
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7509)
  AUTHORS   Tsai,C.N., Lin,C.Y., Lin,C.W., Shih,K.C., Chiu,C.H. and Chen,S.Y.
  TITLE     Clinical relevance and genotypes of circulating noroviruses in
            northern Taiwan, 2006-2011
  JOURNAL   J. Med. Virol. 86 (2), 335-346 (2014)
   PUBMED   24009100
REFERENCE   2  (bases 1 to 7509)
  AUTHORS   Tsai,C.-N., Lin,C.-Y., Lin,C.-W., Shih,K.-C., Chi,H.-C.,
            Chao,H.-C., Lai,M.-W., Yu,T.-H., Chen,S.-Y. and Chiu,C.-H.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JUL-2011) Graduate Institute of clinical medical
            sciences, 259, Wen-Hwa 1st Rd, Kwei-Shan, Taoyuan, Taiwan
FEATURES             Location/Qualifiers
     source          1..7509
                     /organism="Norovirus Hu/GII-4/CGMH01/2006/TW"
                     /mol_type="genomic RNA"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:1195613"
                     /country="Taiwan"
                     /collection_date="13-Jan-2006"
                     /note="serogroup: GII-4"
     CDS             1..5100
                     /note="ORF1; encodes NTPase, 3A, VPg, 3Cpro and 3Dpol"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="AFN09917.1"
                     /translation="MKMASNDASAAAVANSNNDTAKPSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKNIPPPPPNGEDEIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELTPLSLFWRPVYTPQYLISPDALKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEASELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNSFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTSSLIARA
                     SGLLHERLDEFELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIRKCQIVHNGCTYTLESDGKGNVKVDRVQSASVQTNNELTGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVENTEETTSKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTASLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGS
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     gene            5081..6703
                     /gene="VP1"
     CDS             5081..6703
                     /gene="VP1"
                     /note="ORF2"
                     /codon_start=1
                     /product="major viral capsid protein"
                     /protein_id="AFN09918.1"
                     /translation="MKMASNDATPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGTQNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTSRDGSTRGHKATVSTGSVHFTPKLGSVQFSTDTSNDFETGQNTRFTPVGVVQDG
                     STTHQNEPQQWVLPNYSGRDSHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMNLD
                     CLLPQEWVQHFYQESAPAQSDVALLRFVNPDTGRVLFECKLHKPGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGAGRRRAL"
     gene            6703..7509
                     /gene="VP2"
     CDS             6703..7509
                     /gene="VP2"
                     /note="ORF3"
                     /codon_start=1
                     /product="minor viral capsid protein"
                     /protein_id="AFN09919.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAVN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSNPQPPGAAPGGTNLRATVPARGSSSIPS
                     SASIATSVHSNQTASTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSNRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 atgaagatgg cgtctaacga cgcttccgct gccgctgttg ctaacagcaa caacgacacc
       61 gcaaaacctt caagtgacgg agtgctttct agcatggctg tcacttttaa acgagccctc
      121 ggggcgcggc ctaagcagcc tcccccgagg gaaataccac aaagaccccc acgaccacct
      181 actccagaac tggtcaaaaa tattcccccc cccccgccca acggagagga tgaaatagtg
      241 gtttcttata gtgtcaaaga tggcgtttcc ggtttgcctg atctctccac cgtcaggcaa
      301 ccggaagaat ctaacacggc cttcagtgtc cctccactca atcagaggga gaatagagat
      361 gctaaggagc cactgactgg aacaattctg gaaatgtggg atggagaaat ctaccattat
      421 ggcctgtatg tggagcgagg tcttgtacta ggtgtgcaca aaccaccagc tgccattagc
      481 ctcgctaggg tcgaactaac accactctcc ttgttctgga gacctgtgta tactccacag
      541 tacctcatct caccggatgc tctcaagaaa ttacacggag agacgttccc ctacacagcc
      601 tttgacaaca attgctatgc cttttgttgc tgggtcctgg acctaaacga ctcgtggctg
      661 agtaggagaa tgatccagag aacaactggc ttcttcaggc cttaccaaga ttggaatagg
      721 aaacccctcc ccactatgga tgactccaag ttaaagaagg tagctaacat attcctgtgt
      781 gctttgtctt cgctattcac caggcccata aaagatataa tagggaagct aaggcctctt
      841 aacatactca acatcttggc ctcatgtgat tggacttttg caggcatagt ggagtccttg
      901 atactcttgg cagaactctt tggagttttc tggacacccc cagatgtgtc tgcgatgatt
      961 gcccccttac tcggtgatta cgagctacaa ggacctgagg accttgcagt ggagctcgtc
     1021 cctgtagtga tggggggaat tggtttggtg ctaggattca ccaaagagaa aattggaaag
     1081 atgttgtcat ctgctgcttc caccttgaga gcttgtaaag atcttggtgc atacgggcta
     1141 gagatcctaa agttggtcat gaagtggttc ttcccgaaga aagaggaagc aagtgaactg
     1201 gctatagtga gatccatcga ggatgcagtc ctggatctcg aggcaattga aaacaaccat
     1261 atgaccacct tgctcaaaga caaagacagt ctggcaacct acatgagaac ccttgacctt
     1321 gaggaggaga aagccaggaa actctcaacc aagtctgctt cacctgacat cgtgggcaca
     1381 atcaacgccc ttctggcgag aattgctgct gcacgctctc tggtgcatcg agcgaaggag
     1441 gaactttcca gcagaccaag acctgtggtg ttgatgatat caggcagacc aggaataggg
     1501 aagacccacc ttgctaggga agtggctaag agaatcgcag cctcccttac aggagaccag
     1561 cgtgtgggcc tcgtcccacg caatggcgtc gaccattggg atgcgtacaa gggggagagg
     1621 gtcgtcctat gggacgacta tggaatgagc aaccccatcc acgatgccct caggttgcaa
     1681 gaactcgctg acacttgccc cctcacccta aactgtgaca ggattgagaa taaaggaaag
     1741 gtctttgaca gcgatgtcat cattatcacc actaatctgg ctaacccagc accactggac
     1801 tatgtcaact ttgaagcatg ttcgaggcgc atcgacttcc tcgtgtatgc agaagcccct
     1861 gaggtcgaaa aggcgaaacg tgacttccca ggccaacccg acatgtggaa gaactccttc
     1921 agttctgatt tctcacacat aaaactgaca ttggctccac agggtggctt cgacaagaac
     1981 gggaacaccc cacacggaaa gggcgtcatg aagactctca ccactagctc ccttattgcc
     2041 cgggcatcag ggctactcca tgagaggcta gatgaatttg agctgcaggg cccaactctc
     2101 accaccttca actttgatcg caacaaagtg cttgccttta gacaacttgc tgctgaaaac
     2161 aaatatgggt tgatggacac aatgaaagtt gggaggcagc tcaaggatgt caaaacaatg
     2221 ccagagctta aacaagcact caagaatatc tcaatcagga agtgccagat agtgcataat
     2281 ggttgcacct acacacttga gtctgatggc aagggcaatg tgaaagttga cagagttcaa
     2341 agcgcctccg tgcagaccaa caatgagctg actggcgccc tgcaccatct aaggtgcgct
     2401 agaataagat attatgtcag gtgtgtccag gaggccctgt attccatcat ccagattgct
     2461 ggagccgcat ttgtcaccac gcgcatcgtc aagcgcatga acatacaaga cctatggtcc
     2521 aagccacaag tggaaaacac agaggagacc accagcaagg acgggtgtcc aaaacccaaa
     2581 gatgatgagg agttcgtcat ttcatccgac gacatcaaaa ctgagggtaa gaaagggaag
     2641 aacaagactg gccgcggcaa gaagcacaca gccttctcaa gcaaaggtct cagtgatgaa
     2701 gagtacgatg agtacaagag gattagagag gaaaggaatg gcaagtactc catagaagag
     2761 taccttcagg acagggacaa atactatgag gaggtggcca ttgccagggc gaccgaggag
     2821 gacttctgtg aagaggagga ggccaagatc cggcaaagga tcttcaggcc aactaggaaa
     2881 caacgcaagg aggaaagagc ttctctcggt ttagttacag gttctgaaat taggaaaaga
     2941 aacccagatg atttcaaacc caaggggaaa ctgtgggctg acgatgacag aagtgtagac
     3001 tataatgaga aactcagttt tgaagcccca ccaagcatct ggtcgaggat agtcaacttt
     3061 ggttcaggtt ggggattctg ggtctccccc agtctgttca taacatcaac ccatgtcata
     3121 ccccagggcg caaaggagtt ctttggagtc cccatcaaac aaattcaggt acataagtca
     3181 ggcgaattct gtcgcttgag attcccaaaa ccaatcagaa ctgatgtgac gggcatgatc
     3241 ttagaagaag gtgcacccga gggcaccgtg gtcacactac tcatcaagag atccactgga
     3301 gaactcatgc ccctagcagc taggatgggg acccatgcaa ccatgaaaat ccaaggacgc
     3361 actgttggag gtcaaatggg catgcttctg acaggatcca acgccaaaag catggatctg
     3421 ggtactacac caggtgattg tggctgcccc tacatctaca agagaggaaa tgactatgtg
     3481 gtcattggag tccacacggc tgccgctcgt gggggaaaca ctgtcatatg tgccacccag
     3541 gggagtgagg gagaggccac acttgaaggt ggtgacaata aagggacata ctgtggtgca
     3601 ccaatcctag gcccagggag tgctccaaaa cttagcacca agaccaaatt ctggaggtcg
     3661 tccacagcat cactcccacc tggcacctat gaaccagcct atcttggtgg caaggacccc
     3721 agagtcaagg gtggcccttc actgcagcaa gtcatgaggg atcagttgaa gccatttaca
     3781 gagcccaggg gcaagccacc aaagccaagt gtgttggaag ctgccaagaa aaccatcatc
     3841 aatgtccttg agcagacaat tgatccacct gaaaagtggt cattcgcaca agcttgcgcg
     3901 tcccttgaca agaccacttc cagtggccat ccgcaccaca tgcggaaaaa cgactgctgg
     3961 aacggggagt ccttcacagg caagctagca gaccaggctt ccaaggccaa cctgatgttt
     4021 gaagaaggga agaacatgac cccagtctac acagctgcgc ttaaggatga attagttaag
     4081 actgacaaaa tttatggtaa gatcaagaag aggcttctct ggggctcgga tttggcgacc
     4141 atgattcggt gtgctcgagc attcggaggc ctaatggatg agctcaaagc gcactgtgtc
     4201 acacttccca ttagagttgg tatgaatatg aatgaggatg gccccatcat cttcgagagg
     4261 cattccaggt acacatacca ctatgatgct gattactctc gatgggattc aacacaacag
     4321 agagccgtgt tggcagcagc tctagaaatc atggtcaaat tctccccaga accacatttg
     4381 gctcaggtag tcgcagaaga cctcctttct cctagcgtgg tggacgtggg tgacttcaca
     4441 atatcaatca acgagggtct tccctctggg gtgccctgca cctcccaatg gaactccatc
     4501 gcccactggc ttctcactct ctgtgcgctc tccgaagtta caaacttgtc tcctgacacc
     4561 atacaggcta attccctctt ctctttttat ggtgatgatg aaattgttag cacagatata
     4621 aaattggacc cagagaagtt gacagcaaag ctcagggaat atgggttgaa gccaacccgc
     4681 cctgataaaa ctgaaggacc ccttgtcatc tctgaagact taaatggcct gactttcctg
     4741 cggagaactg ttacccgcga cccagctggc tggtttggaa aattggagca gagttcaata
     4801 ctcaggcaaa tgtactggac taggggttcc aaccatgaag atccatctga aacaatgatc
     4861 ccacactccc aaagacccat acaattgatg tccctactgg gggaggccgc actccacggc
     4921 ccggcattct atagcaaaat cagcaagtta gtcattgcag agctaaaaga aggtggcatg
     4981 gatttttacg tgcccagaca agagcctatg ttcagatgga tgagattctc agatctgagc
     5041 acgtgggagg gcgatcgcaa tctggctccc agttttgtga atgaagatgg cgtcgaatga
     5101 cgccacccca tctgatgggt ccacagccaa cctcgtccca gaggtcaaca atgaggttat
     5161 ggctttggag cccgttgttg gtgccgcgat tgcggcacct gtagcgggcc aacaaaatgt
     5221 aattgacccc tggattagaa acaattttgt acaagcccct ggtggagagt ttacagtatc
     5281 ccctagaaac gctccaggtg aaatattatg gagcgcaccc ttgggccctg atttgaatcc
     5341 ctacctctcc cacttggcca gaatgtacaa tggttatgca ggtggttttg aagtgcaggt
     5401 aatcctcgcg gggaacgcgt tcaccgccgg gaaaatcata tttgcagcag tcccaccaaa
     5461 tttcccaact gaaggtttga gccccagcca ggtcactatg ttcccccata taatagtaga
     5521 tgttaggcaa ctggaacctg tgttgatccc cctgcctgat gttaggaata atttttatca
     5581 ttacaaccaa tcaaatgacc ccaccatcaa attgatagca atgctgtata caccactcag
     5641 ggctaacaat gctggggacg atgtcttcac agtctcttgt cgagttctca cgagaccatc
     5701 ccctgatttt gatttcatat ttctggtgcc acccacagtt gagtcaagaa ctaaaccatt
     5761 ctctgtccca atcttaactg ttgaggagat gaccaattca agattcccta ttcctctgga
     5821 aaagttgttc acgggtccca gcagtgcctt tgttgttcag ccacaaaatg gcagatgcac
     5881 gactgatggc gtgctcttag gtactaccca attgtctcct gtcaacatct gcaccttcag
     5941 aggggatgtc acccacattg caggtactca aaattacaca atgaatctgg cctctcaaaa
     6001 ttggaacaat tatgacccaa cagaagaaat cccagcccct ctgggaaccc cagattttgt
     6061 aggaaagatc caaggcgtgc tcacccaaac cacaagtagg gatggctcga cccgcggtca
     6121 caaagccaca gtgagcactg gaagtgtcca cttcacccca aagctgggca gtgtccagtt
     6181 ctccactgat acaagcaatg attttgaaac tggccaaaac acgagattca ccccagtcgg
     6241 tgttgtccag gatggtagta ccacccacca aaatgaaccc caacaatggg tgctcccaaa
     6301 ctattcaggt agagatagtc acaatgtaca cctagcccct gccgtggccc ccactttccc
     6361 gggtgagcaa ctccttttct ttaggtccac tatgcccggg tgcagcgggt atcccaacat
     6421 gaatttggat tgcctactcc cccaggagtg ggtgcaacac ttctaccaag agtcagctcc
     6481 agcacaatct gatgtggcac tgttgagatt tgtgaatcca gacacaggta gggtcttgtt
     6541 tgagtgcaag cttcataaac caggctatgt aacagtggct cacactggcc aacatgattt
     6601 ggttatcccc cccaatggct attttagatt tgattcctgg gtcaaccaat tctacacact
     6661 tgcccccatg ggaaatggag cggggcgtag acgtgcattg taatggctgg agctttcttt
     6721 gctggattgg catctgatgt ccttggttcc ggacttggct ccctaatcaa tgctggggct
     6781 ggggccatca atcaaaaagt tgagtttgaa aataacagaa aattgcaaca agcttccttc
     6841 cagtttagca gcaacctaca acaggcttcc tttcaacatg ataaagagat gctccaagca
     6901 caaattgagg ccaccaaaaa gttgcaacag gaaatgatga aagttaaaca ggcaatgctc
     6961 ctagagggtg ggttctctga gacagatgcg gcccgtgggg cagtcaacgc ccccatgaca
     7021 aaggctttgg actggagcgg aacaaggtac tgggctcccg atgctaggac tacaacatac
     7081 aatgcaggcc gcttttccaa ccctcaaccc ccgggggcag cgccaggggg aactaatctc
     7141 agggctaccg tccccgctcg gggctcctcc agcatacctt ctagtgcttc tattgctact
     7201 tctgtgcact caaatcaaac tgcttcaacg agacttggtt ctacagctgg ttctggtacc
     7261 agtgtctcga gcctcccgtc aactgcaagg actaggagct gggttgagga ccaaaacagg
     7321 aatttgtcac ctttcatgag gggggcccac aacatatcgt ttgtcacccc accatctaat
     7381 agatcctcta gccaaggcac agtctcaacc gtgcctaaag aagttttgga ctcctggact
     7441 ggcgctttca acacgcgcag gcagcctctc ttcgctcaca ttcgtaagcg aggggagtca
     7501 cgtgtgtaa
//