Typing tool

Complete norovirus genomes

HQ449728  GII.12
 GII.P33

Length: 7,523 | 3 CDS

ORF1: 5..5110
ORF2: 5091..6698
ORF3: 6698..7477
LOCUS       HQ449728                7523 bp    RNA     linear   VRL 06-SEP-2011
DEFINITION  Norovirus Hu/GII.12/HS210/2010/USA, complete genome.
ACCESSION   HQ449728
VERSION     HQ449728.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.12/HS210/2010/USA
  ORGANISM  Norovirus Hu/GII.12/HS210/2010/USA
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7523)
  AUTHORS   Takanashi,S., Wang,Q., Chen,N., Shen,Q., Jung,K., Zhang,Z.,
            Yokoyama,M., Lindesmith,L.C., Baric,R.S. and Saif,L.J.
  TITLE     Characterization of Emerging GII.g/GII.12 Noroviruses from a
            Gastroenteritis Outbreak in the United States in 2010
  JOURNAL   J. Clin. Microbiol. 49 (9), 3234-3244 (2011)
   PUBMED   21752978
REFERENCE   2  (bases 1 to 7523)
  AUTHORS   Takanashi,S., Wang,Q., Ning,C. and Saif,L.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (28-OCT-2010) Food Animal Health Research Program, The
            Ohio State University, 1680 Madison Ave, Wooster, OH 44691, USA
FEATURES             Location/Qualifiers
     source          1..7523
                     /organism="Norovirus Hu/GII.12/HS210/2010/USA"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.12/HS210/2010/USA"
                     /host="Homo sapiens"
                     /db_xref="taxon:934293"
                     /country="USA"
                     /collection_date="2010"
     5'UTR           1..4
     CDS             5..5110
                     /note="ORF1; contains RNA-dependent RNA polymerase"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ADT70683.1"
                     /translation="MKMASNDASAAAAAISNNDIAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPRETTQKQKPPRPPTPELVKKIPPPPPNGEDDIVVSYSAKEGVSGLPELSTVRQ
                     PDEVNTAFSVPPLNQRENRDAKEPLPGTILEMWDGEIYHYGLYVERGLVLGVHKPPAA
                     ISLAKVELTPLSLYWRPVYTPQYLISPETLKKLHGETFPYTAFDNNCYAFCCWVLDLN
                     DSWLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIVLCALSTLFTRPIKDII
                     GKLRPLNILNILASCDWTFAGVVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGP
                     EDLAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWF
                     FPKKDEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDLEEEKARKL
                     STKSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLAR
                     DLAKKVAATLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELAD
                     TCPLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPDV
                     EKAKRDFPGQPDMWKDAFRPDFSHIKLMLAPQGGFDKNGNTPHGKGVMKTLTSGSLVA
                     RASGLLHERLDEYELQGPTPTTFNFDQNKVFAFRQLAAENRYGLMDTMRVGSQLKNVK
                     TVSELKQALKNIAIRRCQIVYSGLTYSLESDGKGNVRVEKVQSPAVQTNNELTGALHH
                     LRCARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVGDEGETTSKD
                     GCPKPKDEEEFVISSEDIKVEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREER
                     NGKYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLG
                     LVTGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWV
                     SPSLFVTSTHVIPQGAQEFFGVSIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAP
                     EGTVATLLIKRPTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTP
                     GDCGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEAVLEGGDNKGTYCGAPI
                     LGPGNAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFT
                     EPRGKPPKPSVLEAAKKTIINVLEQTIDPPQKWTFAQACASLDKTTSSGYPHHVRKNE
                     HWNGESFTGKLADQASKANLMFEEGKHMTPVYTGALKDELVKTDKIYGKIKKRLLWGS
                     DLATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYTYHYDADYSR
                     WDSTQQRAVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISITEGLPSGVP
                     CTSQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAK
                     LKEYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTR
                     GPNHEDPAETMIPHSQRPIQLMSLLGEAALHGPSFYSKISKLVISELKEGGMDFYVPR
                     QEPMFRWMRFSDLSTWEGDRNLAPNFVNEDGVE"
     CDS             5091..6698
                     /note="major structural protein"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="ADT70684.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRLNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLSRMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAVPPHFPLENISPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQNEPRMRLVAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFTLPILTIGELTNSRFPVPIDELYTSPNESLVVQPQNGRCALDGELQGTT
                     QLLPTAICSFRGRINQKVSGENHVWNMQVTNINGTPFDPTEDVPAPLGTPDFSGKLFG
                     VLSQRDHDNACRSHDAVIATNSAKFTPKLGAIQIGTWEQDDVHINQPTKFTPVGLFES
                     EGFNQWTLPNYSGALTLNMGLAPPVAPTFPGEQILFFRSHIPLKGGVADPVIDCLLPQ
                     EWIQHLYQESAPSQTDVALIRFTNPDTGRVLFEAKLHRSGYITVANTGSRPIVVPANG
                     YFRFDSWVNQFYSLAPMGTGNGRRRVQ"
     CDS             6698..7477
                     /note="minor structural protein"
                     /codon_start=1
                     /product="small basic protein VP2"
                     /protein_id="ADT70685.1"
                     /translation="MAGAFIAGLAGDIVTNGIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQIQATKQLQADMIAIRQGVLTAGGFSPTDAARGAVNAPMTQVLDWSG
                     TRHWAPGAMKTTAFSGGFTSASHTRTVDLTRKTSATPASMPVSRPSSIASTVSTRSTL
                     ISGSSNPSSLARSSSSISSQSTSPSSRTSDWVRSQNRALEPYMSGALRTAYVTPPSSR
                     ASSNGTVSTVPKEVLDSWTSAFNTHRQPLFAHLRRRGESQV"
     3'UTR           7478..7523
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgctatca gcaacaacga
       61 catcgcaaaa tcttcaagtg acggagtact aagtagtatg gctgtcactt ttaaacgagc
      121 cctcggggcc cggcctaaac agccgccccc gagggaaaca acacaaaaac aaaaacctcc
      181 acgaccgccc accccggagt tagtcaaaaa gattccacct cccccgccca acggggagga
      241 cgatatagtg gtatcctaca gtgccaaaga gggggtctcc ggcctacctg agctatccac
      301 cgtcaggcag ccggatgagg taaacacagc atttagtgtc cccccactca accagaggga
      361 aaatagggat gctaaagaac cgctgcctgg taccatattg gaaatgtggg acggagagat
      421 ctaccactac ggattgtacg tggagcgggg tttggtgctt ggagtgcaca aaccaccagc
      481 ggctattagc ctcgcaaagg ttgaactaac accactgtct ctgtactgga gaccagtgta
      541 cacccctcag tacctcatat ccccggaaac actcaaaaag ctacatggag agacattccc
      601 ttacacggcc tttgataaca actgttacgc cttctgttgt tgggtcttgg atctgaacga
      661 ctcttggctc agcaggagga tgattcagag aacaactggc ttcttcagac cctaccagga
      721 ctggaacagg aaacctctcc ccactatgga tgattccaaa ttgaaaaagg tggctaatat
      781 agtcctgtgt gctttgtcaa cactattcac caggcccatt aaggacataa taggaaaact
      841 aaggccctta aacatactca acatactagc ttcctgcgac tggactttcg caggagtagt
      901 ggaatcccta attctccttg cagaactctt cggagttttc tggacacccc cagatgtgtc
      961 tgcgatgatc gcccccttac taggtgacta cgaactacag ggacctgaag atctcgctgt
     1021 ggaactcgta ccagtagtaa tgggggggat aggtttggtt ctaggtttca ccaaggagaa
     1081 gattggcaag atgctatcat ctgccgcgtc caccctcaga gcttgtaaag accttggggc
     1141 atatgggtta gaaatcctga agttggtcat gaaatggttc ttcccgaaga aagacgaggc
     1201 aaatgaactt gcaatggtga gatccattga ggatgcagtg ctggaccttg aagcaattga
     1261 aaacaatcac atgaccaccc tactcaaaga caaagacagt ttggcaacct acatgaagac
     1321 tctggatctt gaagaggaga aagctaggaa actctccacc aaatccgctt ctcctgatat
     1381 tgtgggcaca atcaattcac tcctggcacg gattgcagct gcccgttccc tggtgcaccg
     1441 ggcaaaagaa gagctttcca gtaggccaag gcccgttgtt gttatgatat caggaaagcc
     1501 aggaataggg aaaacccatc ttgccagaga tttggcaaag aaagttgcag ccaccctcac
     1561 aggagaccag agggtgggcc tcatcccacg gaatggtgtc gaccattggg atgcatacaa
     1621 aggtgagaga gtcgtccttt gggatgacta tggaatgagt aaccccattc atgacgccct
     1681 taggctacaa gaacttgctg acacttgccc cctaacatta aattgtgata ggattgagaa
     1741 caaaggaaag gtttttgaca gtgatgccat aattattaca actaatttgg ctaacccggc
     1801 accactggac tatgttaact ttgaagcatg ttcgaggcgt atcgacttcc ttgtgtacgc
     1861 tgatgccccc gacgttgaaa aggcaaaacg cgacttccca gggcaacctg acatgtggaa
     1921 ggatgctttt agacctgact tctcacacat aaagttaatg ttggctcctc agggtggttt
     1981 tgataagaac ggcaacaccc cacatggaaa aggtgtcatg aaaaccctca catctggctc
     2041 cctcgttgcc cgtgcttcag gactcctcca cgaaagactg gacgagtacg agttgcaagg
     2101 gccaacaccc acaaccttca atttcgacca aaacaaggtg ttcgccttta ggcagctcgc
     2161 cgctgaaaat agatacgggc tgatggacac catgagagtg ggaagccagc tcaagaatgt
     2221 caaaactgtg tcagagctca aacaggcact caagaacatt gcaattagaa ggtgccagat
     2281 agtctacagt ggtctcacat actcacttga atctgatggc aaaggtaatg taagggttga
     2341 gaaggtgcaa agtccagctg tgcagaccaa caatgagcta actggcgcac tacaccatct
     2401 gaggtgcgct aggattagat attatgttaa gtgtgttcag gaagctttgt actccatcat
     2461 ccaaattgct ggagccgcgt tcgtcaccac gcgcattgca aagcgcatga acatacaaaa
     2521 tctctggtcc aaaccacagg tgggggatga gggagagacc accagcaaag acgggtgccc
     2581 aaaaccaaag gatgaggagg agtttgtcat ctcgtctgaa gacattaaag tcgaaggcaa
     2641 gaagggaaag aacaagtctg gccgcggcaa gaaacacaca gccttttcga gtaaaggtct
     2701 tagtgatgag gagtacgatg agtataaaag aattagagaa gaaagaaatg gtaagtactc
     2761 catagaagaa tacctccagg acagagacaa gtactatgag gaggtggcca tagccagggc
     2821 tactgaagag gacttctgtg aggaagaaga agccaagatt cgtcagagga ttttcagacc
     2881 aacaaggaaa caacgcaagg aggagagggc ttcactcggg ctggttacag gctcagaaat
     2941 caggaaaagg aacccggatg acttcaaacc caaaggaaaa ctgtgggctg atgatgacag
     3001 gagtgtcgat tacaatgaaa agctcagttt tgaggccccc ccaagcatct ggtcgagaat
     3061 agtcaacttt ggatcaggtt ggggcttctg ggtctcacca agcctttttg taacatccac
     3121 ccatgtcata cctcaagggg cacaagaatt tttcggtgtt tccatcaaac agatccaaat
     3181 tcacaaatcg ggcgaattct gccgactaag attcccaaaa ccaattagaa ctgatgtgac
     3241 aggtatgatc ctggaggagg gggcccctga agggactgtg gccacactgc tcataaagag
     3301 gccaactgga gagctgatgc cactggcagc tagaatgggt acccatgcaa ctatgaggat
     3361 ccagggtcga actgtcgggg ggcagatggg gatgctcctg acgggatcca acgccaagag
     3421 catggatttg ggtaccacac caggtgactg tggatgccca tacatataca aaagaggaaa
     3481 tgactacgta gtcatcgggg tccacacagc tgccgcccgt ggagggaaca ctgtcatctg
     3541 tgcaacacaa ggaagtgagg gcgaggctgt gcttgaaggt ggcgacaaca aaggcaccta
     3601 ttgtggcgcc ccaatcctag gtccaggaaa tgcccccaaa ctcagtacta aaaccaaatt
     3661 ctggaggtcc tcaacagcac cactcccacc tggcacatat gaaccagctt acctcggagg
     3721 caaagacccc agagtaaaag gtggcccctc attacagcaa gttatgagag accaactgaa
     3781 accatttaca gaacccagag gtaagccacc aaagcccagt gtactagaag cagccaaaaa
     3841 gacaatcatt aatgtccttg agcaaacaat agacccaccc caaaaatgga cgttcgcaca
     3901 ggcgtgcgca tccctcgaca aaacaacctc tagtggctac ccgcaccacg tgcggaagaa
     3961 tgaacattgg aatggggaat ctttcacagg aaaattggct gatcaggctt caaaagctaa
     4021 cctgatgttt gaggaaggta aacacatgac accagtctac acaggagccc tcaaggatga
     4081 gttagtcaaa actgataaaa tatatggcaa gatcaagaag aggttgctat ggggttcaga
     4141 tctggcaacc atgatccgct gcgctcgagc gttcggaggg ttgatggatg aactcaaggc
     4201 tcactgtgtc acactcccca tcagggtagg gatgaacatg aatgaggatg gtcccatcat
     4261 ttttgagaaa cactctagat acacctacca ttatgatgca gactactctc ggtgggactc
     4321 aacacagcag agagctgttt tagctgcagc cctggaaatc atggtaaaat tttccccaga
     4381 accacacctg gcccagatcg ttgcagagga tctcctatct cccagcgtga tggacgtggg
     4441 cgatttcaaa atatcaatca ctgaaggact cccctccggg gtgccttgca catcacaatg
     4501 gaattctatt gctcattggc tcctcacgct ttgtgcactc tctgaggtaa cagatttgtc
     4561 tcctgacatc atccaagcaa actcactctt ctctttctat ggtgacgatg aaattgtgag
     4621 cacagacatc aaattagatc cagaaaagct gacagctaaa ctaaaagagt atggtctcaa
     4681 gccaacccgt cctgacaaga ctgaagggcc tctggtcatt tctgaggact tagatggtct
     4741 gaccttctta cggaggactg tgacccgtga cccagcaggt tggtttggaa aattggaaca
     4801 aagctcaata cttagacaga tgtattggac caggggcccc aaccatgagg atcccgctga
     4861 aacaatgata ccacactccc aaagacccat acagttgatg tccctattag gtgaagctgc
     4921 attacatggc ccatcattct acagcaaaat cagcaaattg gtcatctcag agttgaaaga
     4981 aggtggtatg gacttttacg tgccaaggca agagccaatg tttcgatgga tgaggttctc
     5041 agacttgagc acgtgggagg gcgatcgcaa tctggctccc aattttgtga atgaagatgg
     5101 cgtcgaatga cgccgctcca tctaatgatg gtgcagccgg tctcgtacca gaggtcaaca
     5161 atgagaccat ggcacttgaa ccggtggctg gggcttcaat agccgcccca ctcaccggtc
     5221 aaaataatgt tatagacccc tggattagat taaactttgt gcaggccccc aatggagagt
     5281 ttacagtttc accccgcaat tcgcctgggg aagtcctact aaacttggaa ttaggccctg
     5341 aactaaatcc atatttggca cacctttcca gaatgtacaa tggttatgca ggtggagttg
     5401 aggtgcaagt actactggct gggaacgcgt tcacggctgg aaaactggta ttcgccgcag
     5461 ttccccctca ttttccatta gaaaacataa gccctggcca aataaccatg ttccctcatg
     5521 taattattga tgttaggact ctagaaccag tcctattgcc tcttccagat gttaggaaca
     5581 atttctttca ctacaatcag caaaacgaac caaggatgag acttgtggca atgctctata
     5641 ccccccttag atctaatggt tctggtgatg atgtattcac tgtctcctgt agagtgctta
     5701 ctcgaccctc tcctgatttt gatttcaatt atttggtacc ccctacagtt gaatctaaaa
     5761 ctaaaccctt cacactccct atcttgacca taggggagtt aaccaattcc agattccctg
     5821 tgcctataga tgaactctac actagcccca atgagagttt ggtggtacaa ccccagaacg
     5881 ggagatgcgc gctggatggg gagttgcagg gtactactca gctcctcccc acggcgatct
     5941 gctcgttcag gggtcggatt aatcagaaag tgagtggaga gaaccatgtt tggaatatgc
     6001 aagtcaccaa cattaacgga accccttttg atccaacaga ggatgttcca gctcctctag
     6061 gtacaccaga cttttctggc aagctctttg gcgtcctaag ccagagggac catgacaatg
     6121 cctgtaggag ccatgatgca gtgattgcaa ctaattctgc taaattcacc ccaaaattgg
     6181 gcgctataca aattggcaca tgggaacaag atgatgtaca catcaaccaa cccaccaaat
     6241 ttactccagt tggcttgttt gaaagtgaag gttttaatca gtggacgctc cccaattatt
     6301 ctggagcctt aacactcaac atggggttgg ccccccctgt ggcccccaca tttcctggcg
     6361 agcaaattct tttcttcaga tcccacattc ctcttaaagg aggtgtggca gacccagtta
     6421 ttgattgtct cttgccccag gagtggatcc aacaccttta tcaggagtca gccccttcac
     6481 aaacagatgt agcactgatc agattcacaa atccagacac agggcgtgtc ctatttgaag
     6541 caaaattgca caggagtggc tacatcacag tggccaacac tggtagcaga ccaattgtgg
     6601 tgccagctaa tggttacttc aggtttgact cttgggttaa tcagttttat tctctcgccc
     6661 ccatgggaac tgggaatggg cgcagaaggg tgcagtaatg gctggagctt tcatagcagg
     6721 tcttgctggt gatatagtca ccaatggcat tggctcactc gtgaacgctg gggccaatgc
     6781 aataaaccaa aaagtagact ttgaaaacaa taagcaacta cagcaggcat ccttcaatca
     6841 tgacaaagag atgctgcaag cccaaattca agccaccaaa cagttacagg ctgatatgat
     6901 tgcaatcaga caaggggtgt tgaccgcggg cggcttctcc cccactgatg cagcaagagg
     6961 tgcagtcaac gcacccatga cacaggtctt ggattggagc ggaactagac attgggcccc
     7021 cggagccatg aaaacaactg ctttctccgg tgggttcacc agtgcttctc ataccaggac
     7081 cgttgacctg actaggaaga catcagccac accagcctct atgcctgtct ctagacccag
     7141 ttctattgcc tctactgttt ctacccgttc taccttgatt agtggatcct ctaatccttc
     7201 ttctctagct aggagttctt ccagtatttc ttcccaatct acttccccat cctctcggac
     7261 tagtgattgg gtacgtagcc aaaacagagc actggagcct tacatgagcg gggcgctgcg
     7321 tacagcctac gtgacacctc catctagtag ggcttctagc aatggcacag tctcaaccgt
     7381 gccaaaagag gttttggact cctggacatc tgcatttaac acacacagac aaccgctgtt
     7441 tgctcatctc cgtcggagag gggagtcaca agtttagtga aaagatggtc ttttctttca
     7501 ttcctttgaa atttctgtct ttt
//