Typing tool

Complete norovirus genomes

HQ392821  GII.11
 GII.P11

Length: 7,548 | 3 CDS

ORF1: 6..5087
ORF2: 5071..6714
ORF3: 6714..7475
LOCUS       HQ392821                7548 bp    RNA     linear   VRL 01-JUN-2012
DEFINITION  Norovirus pig/GII/Ch6/China/2009, complete genome.
ACCESSION   HQ392821
VERSION     HQ392821.1
KEYWORDS    .
SOURCE      Norovirus pig/GII/Ch6/China/2009
  ORGANISM  Norovirus pig/GII/Ch6/China/2009
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7548)
  AUTHORS   Shen,Q., Zhang,W., Yang,S., Cui,L. and Hua,X.
  TITLE     Complete genome sequence of a new-genotype porcine norovirus
            isolated from piglets with diarrhea
  JOURNAL   J. Virol. 86 (12), 7015-7016 (2012)
   PUBMED   22628399
REFERENCE   2  (bases 1 to 7548)
  AUTHORS   Shen,Q., Zhang,W. and Hua,X.
  TITLE     Recombinant Porcine Norovirus Isolated from China That Contributed
            to a Sporadic Cases of Gastroenteritis in Piglet
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7548)
  AUTHORS   Shen,Q., Zhang,W. and Hua,X.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-OCT-2010) School of Agriculture and Biology, Shanghai
            JiaoTong University, 800 Dongchuan Road, Shanghai 200240, P.R.
            China
FEATURES             Location/Qualifiers
     source          1..7548
                     /organism="Norovirus pig/GII/Ch6/China/2009"
                     /mol_type="genomic RNA"
                     /isolation_source="fecal sample"
                     /host="swine"
                     /db_xref="taxon:1088689"
                     /country="China"
                     /collection_date="Aug-2009"
                     /note="group: GII"
     5'UTR           1..5
     CDS             6..5087
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="AEP04092.1"
                     /translation="MKMASNDATTASCGENTTKKDSDKPFWSFSSKGDFFSNVKVGFK
                     KKTTKTPPEEPFIPPDDRGGAEQVQPLEEPADTTLRYNARDNTIEGLPELDYVEMDET
                     KDTAYAVPPLNLREHQPAPEPLPGAIIEMWDGEIYHYGIYAGGGKVLGVHKPAAAICL
                     ATIELTPISLYWRVVYTPQNSIPIDSLRRLAGERFPYTAFDNNCYTFCCWVLDLNDSW
                     LSRRMVTRTTGFFRPYQDWNTKPVPTVDDSKLKKVANVILCGLTSLFSRPIKDIVGKL
                     KPLNLINILATCDWTFGGIVESLVLVGELFGIFWTPPDVTSFLASILDDFQLQGPEDL
                     AAEVVPVLMGGLGLVLGFTTEKIGRMLSSAASTLRACKDLGAYGLDILKLVVKWFFPK
                     KEEQAELEMVRSIEDAVLDLEALENNHLTTLLKDKDSLTAFMKTLDMEEEKARKLSTR
                     SSSPDIVGTINALLARISAARSLLHKAREELCARIRPVVVMISGRPGIGKTHMARHLA
                     QKVAAAIGGDKRIGLVPRNGVDHWDAYKGERIVLWDDYGMSNPIKDALTLQELADTCP
                     VTLNCDRIENKGKLFDSDIIVITTNLTSPAPLDYVNFEACSRRVDFLVYAESPDVEKV
                     KKEFPGQPDMWKDAYQQDHSHIKLQLAPQGGFDKNGNTPYGKGVMKTLTQNSLVARVA
                     ALVHERADEFALRGDDLPLYNFDVDKINSFRKMAADNRYGFFETMKVGAALKNVDSME
                     GLKTALKGVTLKPCKVVYKGTIYQIESGRGGLAVKKLEDRYAQSSGSLFGVLTRVRQA
                     RAKYYLKCFQELIYTTLQIAGAAFVTSRIVRRSNWCNSWRQAAEPGTLAPAEEPLPAQ
                     PQDWEVTPVAADQEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEYKRIREEREGKYSIE
                     EYLRDRDRYYEELAIAQATEENFAEDDEMRLRQRIFRPTKKQRREERATLGLVSGTEI
                     RKRKADDFQPKGKLWADDSREVDYNETINFEAPSSIWSRVVPFGTGWAFWVSPSLLIT
                     TTHVVPKDTTEIFGVPIAQIQVHKSGEFCRLRFPRPMRTDVNGLILEEGAPEGTVCTI
                     LIKRSSGELLPLAVRMGTHATMKIQGRTIGGQMGMLLTGANAKNMDLGTSPGDCGCPY
                     IYKRGNDFVVAGVHTAAARGGNTVVCATQGPDGEATLEGGENHGTYCGAPILGPGKSP
                     KLSTKTKFWRSSTAPLPPGTYEPAYLGGRDPRVENGPSLQQVMRDQLKPFTAPRGKPP
                     KPSVLDSAKDTIVNFLEQTLEPAKKWSYSQACQSLDKTTSSGDPHHVRKNDHWNGETF
                     TGPLADQASKANLLYEQGKHVQPVYTAALKDELVKTEKIYGTVKKRLLWGSDLGTMIR
                     CARAFGGLMEEMKENCILLPIRVGMNMNEDGPAIFERHARHTYHFDADYSRWDSTQQR
                     GILAAALDIMVKFSAEPELAQVVAEDLLAPSVLDVGDFRISIVEGLPSGVPCTSQWNS
                     FAHWLITLCAMSEVTGLSPDVIQAHSCFSFYGDDEIVSTDITLDPNKLTEKLKEYGLK
                     PTRPDKTEGPLVIQKNLAGLTFLRRTIVRDPAGWFGKLDKDSILRQLYWTRGPNHEDP
                     METMVPHSQRAVQLMALLGEASLHGSNFYSKVSRMVINEIKEGGLEFYVPRHEAMFRW
                     MRFSDLSTWEGDRNLAPNGVNEDGV"
     CDS             5071..6714
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="AEP04093.1"
                     /translation="MKMASNDAAPSTDGSAGLVPEVNNETMALEPVVGAPLAAPVAGQ
                     HNIIDPWIKMNFVQAPNGEFTVSPRNAPGEILLDLELGPDLNPYLSHLARMYNGYAGG
                     MEVQVVLAGNAFTAGKIIFAAVPPNFPAENLSAAQVTMCPHVIVDVRQLEPVMLPMPD
                     IRNKLFHYNQVDDPKLRLLAYLYTPLRANNAGDDVFTVSCRVLTRPTPDFEFMFLVPP
                     TVESKTKPFSLPSLTLDELSNSRFPAPIVQLYTNPHDNLVVQPQNGRCTIDGLLQGTT
                     QLVSCNVCSFRGTIGDGQPASHSEEEIMPMAFNIQRELMLENLDGSPYDPTDDIPAVL
                     GSPDFQGVIFGILSQRNGDGQTRAHEAKVDTRAARFAPKLGFVVATVESTDFHANQPS
                     RFTPVGLGGDGNQDFAQWNLPTYGGALTNNTNLAPPVMPVYPGEQLLFFRSQLPSSGG
                     VVGGWLDCLLPQEWVQHFFQESATSQSDVALVRYINPTTGRVLFEAKLHKQGFLTVAA
                     SGSYPLVVPADGYFRFESWVNQFYTLAPMGNGSGRRRTR"
     CDS             6714..7475
                     /codon_start=1
                     /product="minor structural protein"
                     /protein_id="AEP04094.1"
                     /translation="MAGQILLGLATDLIGGGIGSLINAGANAINQKVEYDFNKKLQSF
                     SFAHDKEMLQAQVDATRQLQQDLIQLKQDTLLSAGYLPADAARGSLGVPMTKALDWNG
                     TRYWAPNSMSTSSYSGRFSRPTSNLTFQNPQPPRQPPKAPTSTSGSTSASSVSSAPTV
                     STGLSSSSTTPSRSSRSSTTTDRTREWVDSQNLGPYMDGALQTAFVTPPSSRSSSVGT
                     VSTVPDFVLDSWTPSFNTRRQPLFAHLRRRGESQA"
ORIGIN      
        1 gtgaaatgaa gatggcgtct aacgacgcta ccactgcctc ttgtggcgaa aacaccacta
       61 agaaagacag tgacaagccc ttttggagct ttagctccaa aggggacttc ttctccaacg
      121 ttaaagttgg ttttaagaaa aagactacta agactccacc agaggagccc ttcatccccc
      181 ctgatgatcg gggtggggcg gaacaggtcc aacccctcga agaacccgcg gataccaccc
      241 taaggtataa cgcgcgggat aacacaattg aagggctccc tgaacttgat tacgtcgaaa
      301 tggatgagac caaggacacc gcctacgccg tcccaccact caatttgcga gaacaccaac
      361 cagcgcccga accactcccg ggcgcgataa tagagatgtg ggatggcgag atttaccact
      421 atggtatcta tgctggtggt ggtaaagttc tgggtgtgca caaaccagca gccgccatct
      481 gcctggcgac cattgagctg acccccatct ctctttactg gagagtcgtc tacacacccc
      541 agaactccat ccccatagat tcactgcgcc gcctggcagg cgagcgcttt ccttacacag
      601 cctttgataa caactgctac actttctgtt gctgggtttt ggaccttaat gactcatggc
      661 tctctaggag gatggtcact aggaccactg gtttctttag gccctaccaa gactggaaca
      721 ccaaacctgt ccctacagta gatgacagca agctgaaaaa ggttgccaac gtgattctat
      781 gcggcctgac ctcccttttc tctagaccca tcaaagacat agttgggaag cttaagcccc
      841 ttaacctcat caatatactg gcaacctgtg attggacttt tggcggaatt gtggagtccc
      901 ttgtcctggt gggtgagctt ttcgggatct tctggacgcc gccagatgtt accagttttc
      961 ttgcttcaat cctagatgac ttccagctcc agggcccaga ggatttagca gctgaggtcg
     1021 tcccagtact tatggggggt ctcggattag tccttggctt caccacagaa aagattgggc
     1081 gcatgctgtc atccgctgct tcgacgctgc gcgcctgtaa agaccttggg gcctatggcc
     1141 tcgacatatt gaagctggtg gtcaagtggt tcttcccgaa aaaggaggaa caagcagagc
     1201 ttgaaatggt gcgttcaata gaggacgccg ttttggacct tgaggcgttg gaaaacaacc
     1261 acctcaccac ccttcttaag gacaaggata gcctgacggc gtttatgaag actctcgata
     1321 tggaggaaga aaaggcgcgg aagctttcaa cgcgctcgtc atcaccagat attgtcggca
     1381 ccataaacgc cttgctcgcc agaatttcag cagccaggtc gctcctacac aaggcacggg
     1441 aagaactttg cgccaggatt cgcccggtgg tcgtcatgat ctccggcaga ccgggcatag
     1501 gcaaaaccca catggcccgc cacttggcgc aaaaggtcgc tgcggccatt ggtggcgaca
     1561 aaaggatcgg cttggtgcct aggaatggcg ttgaccactg ggacgcctac aagggagaac
     1621 gcatagtctt gtgggatgat tatggtatga gtaacccaat caaggatgcc ttgacactcc
     1681 aggagttggc cgacacgtgc ccagtcaccc taaattgtga taggattgag aataagggta
     1741 aactctttga tagtgacatc attgtgataa ccaccaattt gaccagccct gccccacttg
     1801 actatgttaa ttttgaggct tgctctagac gggtggactt cctggtctat gcggagtcac
     1861 ctgacgttga gaaggtgaag aaagagtttc ctggccaacc cgacatgtgg aaggacgctt
     1921 atcaacagga ccactcgcac atcaagctac agctggcccc tcaaggaggt tttgataaaa
     1981 atggtaacac cccttatgga aagggcgtga tgaagacact cacccaaaac tccctcgtgg
     2041 cgcgtgtcgc cgccctcgtc catgagaggg ctgatgagtt cgccctacgg ggtgacgatc
     2101 tgcccctcta caacttcgat gtggacaaga taaactcctt caggaagatg gctgctgaca
     2161 acagatacgg gttctttgag acaatgaagg tcggggctgc tctgaaaaat gtggattcaa
     2221 tggagggtct caagactgcc ctaaaagggg tcaccctgaa accctgcaag gtggtttaca
     2281 aggggacgat ctaccagatt gagtcaggcc gtggcggact cgcggtcaag aagctagagg
     2341 accgctatgc ccaaagctct ggttccttat ttggtgtgct cacgagagtc cgccaggcga
     2401 gagccaaata ctaccttaaa tgctttcagg agctgattta caccaccctg cagatcgctg
     2461 gggccgcttt cgtgacatcg aggatagtta ggaggtctaa ctggtgcaac tcttggcgac
     2521 aggcagctga gcccggcacc ttggccccag ccgaggagcc actcccagca caaccccaag
     2581 actgggaggt cacccctgtt gcggcagatc aggagggaaa gaaggggaag aacaaaaagg
     2641 gtcgtggaaa gaaacacacg gccttctcca gcaagggact cagtgatgag gagtatgatg
     2701 agtataaaag gataagggag gaacgcgagg gcaagtattc cattgaagaa tacctccgcg
     2761 accgagaccg ctactatgaa gagctggcca tcgcacaagc aacagaagag aacttcgcag
     2821 aggatgatga gatgaggctc cgccagagaa ttttcaggcc caccaagaag cagaggaggg
     2881 aggagagagc cactcttggc ttggtgtctg gcactgaaat cagaaaaagg aaggctgatg
     2941 acttccaacc taagggtaaa ctgtgggctg acgacagtcg tgaggtcgac tacaacgaga
     3001 ccatcaattt tgaggcccca tcaagcatct ggtcacgtgt cgtccccttt ggcaccggct
     3061 gggccttctg ggtgtccccg agccttttga ttaccaccac tcatgtcgtg cccaaggata
     3121 caaccgagat ctttggtgtg ccaatcgcgc agattcaagt ccataaatca ggcgagtttt
     3181 gccgcctgag attcccccga cctatgagga ctgatgtcaa tggcctgatc ttggaggagg
     3241 gcgcccccga gggcactgtt tgcaccatcc ttattaagag atccagtgga gaactcctgc
     3301 cccttgcggt gagaatggga acccacgcca ccatgaagat acaaggcaga acaattggcg
     3361 gccagatggg catgctcctc actggggcta acgcaaagaa catggacctg ggaactagtc
     3421 ctggagactg cggctgcccc tacatataca agaggggtaa tgactttgtg gtcgcggggg
     3481 tgcacactgc tgctgcgagg ggcggtaaca cggtggtctg tgccactcag ggtcctgatg
     3541 gtgaggccac cttagagggc ggtgagaacc acggcactta ctgtggcgcc ccaatcttgg
     3601 gaccagggaa atctcccaag ttgagcacaa agactaagtt ttggaggtcc tccacggccc
     3661 cgcttccccc tggaacctat gaaccagcct atctgggtgg gagagacccc cgcgtggaaa
     3721 atggcccatc actacagcag gtcatgagag accaacttaa gcccttcacc gcccctagag
     3781 gaaagccacc taaaccctct gtcctggact ccgccaagga caccatagtg aactttctgg
     3841 agcagaccct tgaacccgct aaaaagtgga gttactcaca ggcttgccaa tccttggaca
     3901 agaccacctc tagcggcgat ccccaccatg ttaggaagaa tgaccattgg aatggtgaga
     3961 ccttcacggg ccctctggca gaccaggcct caaaggctaa tctcctctac gagcagggta
     4021 aacatgtcca acccgtctac acggccgccc tgaaggatga acttgtcaag accgaaaaga
     4081 tttacggcac agtgaagaag aggctcctct ggggctcgga cctgggcacg atgatcagat
     4141 gtgcacgagc ctttggaggt ttgatggagg agatgaaaga gaactgcatt ctgctgccaa
     4201 tcagggtagg gatgaacatg aacgaggatg gaccagctat cttcgagagg cacgcgcggc
     4261 acacctacca ctttgatgct gactactcac ggtgggactc cacccaacaa agaggcatcc
     4321 tagccgccgc gttggacatc atggtgaagt tttccgccga accggagcta gctcaggtgg
     4381 tggcggagga tctccttgcc cccagcgtcc tcgacgttgg cgatttccgc atctctatcg
     4441 tggagggcct cccctctggg gtcccgtgta catcacaatg gaactccttt gcccattggc
     4501 tgatcactct ctgtgccatg tcagaagtga cgggtctctc acccgacgtg attcaggccc
     4561 attcctgctt ttccttctat ggtgatgatg agatcgtgag cacggacatc actttggacc
     4621 ccaataaact tacagaaaaa ttgaaagaat atggcctgaa gccaactagg ccagacaaaa
     4681 ctgaaggacc cttggtgatc cagaagaact tggcagggct aaccttcttg aggaggacga
     4741 tagtccgcga cccagctggt tggtttggta agcttgacaa ggactccatc ttgaggcaac
     4801 tctactggac cagagggcca aaccatgaag accccatgga aactatggtg ccacattcgc
     4861 aaagagcagt acaattgatg gccctcctgg gagaggcctc actgcatggt tccaacttct
     4921 acagcaaagt gagcagaatg gtaataaatg agataaaaga aggtggtctg gaattttacg
     4981 tgcccagaca cgaagccatg tttcgctgga tgcggttctc agacctcagc acgtgggagg
     5041 gcgatcgcaa tctggctccc aatggtgtga atgaagatgg cgtctaacga cgctgctcca
     5101 tctacggatg gatctgccgg tctcgtgcca gaggtcaata acgagactat ggctttggaa
     5161 ccagttgtgg gggctcctct cgctgctcct gtagctggcc aacataatat tatagacccc
     5221 tggattaaaa tgaattttgt gcaggcaccc aatggagagt ttacggtttc ccctcggaat
     5281 gcccccggtg aaattttgtt agacttggaa cttggccctg accttaaccc ttatctttct
     5341 cacctggccc gcatgtacaa cggctatgcg ggtggcatgg aggtgcaggt tgttttagca
     5401 ggaaatgctt ttactgccgg gaagattatt tttgctgctg ttccacctaa cttcccagca
     5461 gagaacctca gtgccgccca ggttaccatg tgtccccatg tgatagttga tgtcaggcaa
     5521 ttggaaccag tcatgctccc catgcctgat attaggaaca aactatttca ttacaaccaa
     5581 gttgatgatc caaagcttag attgttggct tacctttaca caccccttcg agccaacaat
     5641 gctggagatg atgttttcac ggtttcttgc cgggttctta ctaggccaac tcctgatttt
     5701 gagtttatgt ttttggttcc ccccactgtt gaatctaaaa ctaagccttt ttctttacct
     5761 agtcttaccc ttgatgaact ttccaattcc aggtttcctg cgcctatagt gcagctttac
     5821 acaaaccctc atgacaacct ggttgtgcaa ccccaaaatg ggaggtgcac tatagatggc
     5881 ctcttgcagg gcaccacaca actcgtgtcc tgtaatgttt gcagttttag agggaccatc
     5941 ggtgatggac agccggcaag ccacagtgag gaggagatca tgcccatggc cttcaacatc
     6001 caacgtgagc tcatgctaga aaaccttgat ggctcaccct atgacccaac tgatgacatc
     6061 cccgcagtgc tgggctcccc tgactttcag ggtgtcatat ttggcatcct cagtcagagg
     6121 aatggtgatg ggcaaaccag ggcacatgag gccaaggtgg acaccagggc ggcccgcttc
     6181 gcccctaaac ttggctttgt tgtggccact gtggagagca cagacttcca cgccaatcag
     6241 cctagcagat tcacccctgt tgggttaggt ggggatggca atcaggactt tgctcagtgg
     6301 aatctaccaa cctacggtgg cgcgctgacg aacaacacca acctcgcccc acccgtgatg
     6361 cccgtttacc caggggagca actcctattc ttccgctccc agctaccgag ctctggtggt
     6421 gtggttggcg ggtggctgga ttgcctgctc cctcaggagt gggttcaaca cttcttccag
     6481 gagtcggcca cctctcaaag cgatgtggcc ctagtcaggt atataaaccc caccacgggc
     6541 agggtgcttt ttgaggcaaa gttgcataaa cagggctttc tcactgtggc cgcctcgggt
     6601 tcttacccct tggttgttcc cgccgatggt tatttcagat ttgagtcctg ggtgaatcag
     6661 ttttatactt tagcccccat gggaaatggt agtgggcgta ggagaacccg ttaatggcag
     6721 gacaaatttt attgggctta gctactgatc ttattggggg tgggataggt tctttaatca
     6781 atgctggtgc taatgcaatt aatcagaagg ttgagtatga ttttaataag aagttgcaat
     6841 ctttctcttt tgcccatgat aaagagatgc tacaagcaca agtggatgca actagacaat
     6901 tacagcaaga tttgattcaa ttgaagcaag atactctgct ttctgctggt tatctccctg
     6961 ctgatgcagc tagaggctct cttggtgtgc ccatgactaa ggctctggac tggaatggta
     7021 cgagatactg ggcacctaat tctatgagca cctccagcta ttcagggcgt ttctctcgcc
     7081 ccacttcaaa cttgaccttc cagaacccgc aacctcctcg ccaaccaccc aaggctccaa
     7141 cttccacttc ggggtctacg agcgcctctt cggtctcgtc agccccaact gtgtcaacag
     7201 ggctgtccag ttcttccact actccatcac ggtcgtcaag gtcttcaacc accacagaca
     7261 ggaccagaga gtgggtggat tcacagaacc taggccccta tatggatggt gccctgcaga
     7321 cggcgtttgt tacacctccg tctagcagga gctctagtgt cggcacggtc tcgaccgtgc
     7381 cagactttgt tttggactca tggacccctt cctttaacac gaggaggcaa ccgctgtttg
     7441 cacacctacg cagacgggga gagtcacaag cttaacagct tagtgaaaga tagggttttt
     7501 ctttttcttt cttttctgtt ccctgatctc caaaaaaaaa aaaaaaaa
//