Typing tool

Complete norovirus genomes

HQ169542  GII.6
 GII.P6

Length: 7,547 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6722
ORF3: 6722..7498
LOCUS       HQ169542                7547 bp    RNA     linear   VRL 22-JUL-2016
DEFINITION  Norovirus Hu/GII.6/186/2005/USA, complete genome.
ACCESSION   HQ169542
VERSION     HQ169542.2
KEYWORDS    .
SOURCE      Norovirus Hu/GII.6/186/2005/USA
  ORGANISM  Norovirus Hu/GII.6/186/2005/USA
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7547)
  AUTHORS   Chen,H., Chen,X., Hu,Y. and Yan,H.
  TITLE     Reproducibility, fidelity, and discriminant validity of linear RNA
            amplification for microarray-based identification of major human
            enteric viruses
  JOURNAL   Appl. Microbiol. Biotechnol. 97 (9), 4129-4139 (2013)
   PUBMED   23455564
REFERENCE   2  (bases 1 to 7547)
  AUTHORS   Chen,H. and Goswami,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUL-2010) CFSAN MOD1, Food and Drug Administration,
            8301 Muirkirk Rd, Laurel, MD 20708, USA
REFERENCE   3  (bases 1 to 7547)
  AUTHORS   Chen,H. and Goswami,B.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUL-2016) CFSAN MOD1, Food and Drug Administration,
            8301 Muirkirk Rd, Laurel, MD 20708, USA
  REMARK    Sequence update by submitter
COMMENT     On Jul 12, 2016 this sequence version replaced HQ169542.1.
FEATURES             Location/Qualifiers
     source          1..7547
                     /organism="Norovirus Hu/GII.6/186/2005/USA"
                     /mol_type="genomic RNA"
                     /isolate="186/GII.6/USA"
                     /isolation_source="stool sample"
                     /host="Homo sapiens"
                     /db_xref="taxon:884091"
                     /country="USA"
                     /collection_date="2005"
                     /note="genotype: GII.6"
     CDS             5..5098
                     /note="ORF1"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ANS11344.1"
                     /translation="MKMASNDATSAFGSQNSVNDSINTTPSNKEEVGAFSNIKVGLKK
                     MLGAVPKNTKAPSDDRHCPTVKIGSKTLVIPPEPPNGEDIVQFDAKSETVRGLPDLTT
                     VQNEHENTPYTVPPLSEREHRPAAEPLPGTILEMWDGEFYHYSIYVSGGKALGVHKPP
                     AAISLATVELTPISLYWRPVYTPNYLVHPDTLKGLAGEKFPYTAFSNNCYNFCCWVLE
                     LNDTWLCRRSISRTTGFFKPYQSWNRKPLPTIDDGKIKKVANAILCALGSLFSKPIKD
                     LLGKLKPLNLLHLLASCDWTFAGIVETVILMAELFNVFWTPPDVSNFIASLIGDFQLQ
                     GPEDLAVELVPVVMGGIGMVLGFTAEKIGRMLSSAASTLRACKDLGNYALDILKLVMK
                     WFFPKKEEKAEMETLRAIEDAVLDMEAIGNNHLTTLLKDKDSLTAFMKTLDLEEEKAR
                     KLSTKSSSPDIVGTINAILARIAAARSLLHKAKEEMFSRIRPVVVMISGRPGIGKTHM
                     ARHLAKSIANTMNGDQRVGLVPRNGVDHWDAYRGERVVLWDDYGMGNPVKDALTLQEL
                     ADTCPVTLNCDRIENKGKMFDSDVIIITTNLVNPAPLDYVNFEACSRRIDFLVYAESP
                     EIEKVKRDFPGQPDMWKDHFKPDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSL
                     TARVAGLVHERRDEFQLQGDSLQTYNFDTNRVSAFRKLAADNKYGIMETMRVGAALKN
                     VKTLEDLRVALRDVKFNECEIIYRNTKYRVSSDGKGTVSVNKVEDLTSQTANEVSSAL
                     LRLRQARARYYVSCFQDLVYTLIQVAGASFVVNRISKRFCWERWVKPTETQETSEPEK
                     ETAQSEWEIEPKDTEPEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEYKRIREERNGKY
                     SIEEYLQDRDRYYEEVAVARATEEDFCEEEEAKIRQRIFRPTRKQRKEERGVLGLVTG
                     TDIRKRRPDDFQPKGNLWADDTRSVDYNERLDFEAPPSVWSRIVPLGTGWGFWVSSNL
                     LITTTHVLPKGIKELFGVDVKQIQIHKSGEFCRFRFPKPIRPDVSGLVLEEGAPEGTV
                     CSILVKRPTGEMIPLAVRMGTHASMKIQGRTVGGQMGMLLTGANAKNMDLGTGPGDCG
                     CPYIYKRGNDIVVAGVHTAAARGGNTVICATQGQDGEAVLEGNESLGTYCGAPILGPG
                     KAPKLSTKTKFWRSSPDALPPGTYEPAYLGGKDPRVEKGPSLQQVMRDQLKPFTEPRG
                     KPPRPTVLEEAKKTVMNVLEQTIDPAKPWTYSQACASLDKTTSSGSPHHIRKNDHWNG
                     ESFTGPLADQASKANLMYEQAKHMQPVYTAALKDELVKTDKIYKKIKKRLLWGSDLGT
                     MVRCARAFGGLMDSMKASCIALPCRVGMNMNEDGPIIFDKHSKYRYHYDADYSRWDST
                     QQRSILSAAMDVMVRFSAEPELAQVVAEDLLAPSQLDVGDFVISVQEGLPSGVPCTSQ
                     WNSIAHWILTLSAMAEVSGLSPDVVQAHSCFSFYGDDEIVSTDINLDPSKLTQKLREY
                     GLVPTRPDKTEGPLVITEDLTGLTFLRRSIARDPAGWFGKLDQDSILRQLYWTRGPNH
                     ENPYESMVPHSQRATQLMALLGEASLHGPQFYKKVSKMVISEIKSGGLEFYVPRQEAM
                     FRWMRFSDLSTWEGDRNLAPESVNDDGVE"
     CDS             5079..6722
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="ADN06080.2"
                     /translation="MMMASNDAAPSNDGAANLVPEANNEVMALEPVVGASIAAPVVGQ
                     QNIIDPWIRENFVQAPQGEFTVSPRNSPGEMLLNLELGPELNPYLSHLSRMYNGYAGG
                     MQVQVVLAGNAFTAGKIIFAAVPPHFPVENISAAQITMCPHVIVDVRQLEPVLLPLPD
                     IRNRFFHYNQEDTPRMRLVAMLYTPLRANSGEDVFTVSCRVLTRPAPDFEFTFLVPPT
                     VESKTKPFTLPILTLGELSNSRFPAPIDMLYTDPNETIVVQPQNGRCTLDGTLQGTTQ
                     LVPTQICSFRGTLVSQTSRSADSTDSAPRVRNHPLHVQLKNLDGTPYDPTDEVPAVLG
                     AIDFKGTVFGVASQRNTTGGSVGATRAHEVHIDTTNPRYTPKLGSVLMYSESSDFDDG
                     QPTRFTPIGMGADDWRQWELPEYSGHLTLNMNLAPAVAPAFPGERILFFRSVVPSAGG
                     YGSGQIDCLIPQEWVQHFYQEAAPSQSAVALIRYVNPDTGRNIFEAKLHREGFITVAN
                     SGNNPIVVPPNGYFRFEAWVNQFYTLTPMGTGQGRRRVQ"
     CDS             6722..7498
                     /note="ORF3"
                     /codon_start=1
                     /product="capsid protein VP2"
                     /protein_id="ANS11345.1"
                     /translation="MAGAFFAGLAGDAITNGVGSLINAGANAINQKVEYDFNKQLQLA
                     SFKHDKEMLQSQVLATKQLQQEMMNIRQGVLTAGGFSPTDAARGAVNAPMTKILDWNG
                     TRYFAPNSMKTTSYSGQFSSNPVHRQPTLSRPDSQKVKINSDSASIYSSMSTAPSQST
                     HSMILTSGSGSSRTTSSPTVTSTLSRTSDWVRGQNERLSPFMDGALQTTFVTPPSSRA
                     SSNGSVSTVPKAVLDSWTPMFNTHRQPLFAHLRRRGESQV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac ctctgccttt ggcagtcaaa actctgtcaa
       61 tgacagtatc aacaccaccc cttccaataa agaagaggtt ggtgcattct ccaacatcaa
      121 agttggactt aagaaaatgc tgggtgccgt gcctaaaaac accaaagcac ccagcgatga
      181 ccggcactgc cccacagtta agatcgggtc caaaacacta gtgatcccgc cagaaccccc
      241 aaacggtgag gatattgtgc agttcgatgc aaaatcagaa actgtacgtg ggctacccga
      301 cctgacgaca gtgcagaatg aacatgagaa caccccgtac acagtccctc cactgagtga
      361 aagggaacac aggccagccg ctgagccact ccccggcaca atactagaga tgtgggatgg
      421 tgaattctac cattactcca tctacgtcag cggaggcaaa gctctggggg tgcacaaacc
      481 cccagcggct ataagcctcg cgacagtgga actcactccc atatcccttt actggcgacc
      541 tgtctacact ccaaactacc tggtccaccc agatacactg aagggtcttg ctggtgaaaa
      601 gtttccctac acggccttta gtaacaactg ctacaatttc tgttgttggg tgcttgagct
      661 taacgacacg tggctttgca ggaggagtat atccagaacc actggcttct ttaagccata
      721 tcagtcttgg aacaggaagc ccctccccac cattgatgat ggaaaaatca aaaaggtggc
      781 caatgcaatt ctctgcgcac ttggctcatt gttctcaaag ccaatcaaag acctactggg
      841 caaactcaag ccacttaacc tactgcatct gcttgcgtcg tgtgactgga cgtttgcggg
      901 tatagtagag acagtcatct taatggcgga actcttcaat gtgttctgga ccccacctga
      961 tgtttccaat ttcatagcct ccttgatagg tgattttcag ttacaaggac ccgaggactt
     1021 ggctgtggag ctcgtccccg tggttatggg aggcatagga atggtcctcg gtttcactgc
     1081 cgagaagatt ggccgcatgt tgtcatctgc tgcgtcaact ctaagggcat gcaaagatct
     1141 ggggaactac gccctagaca tactaaaact agttatgaag tggttctttc caaagaaaga
     1201 agagaaggcc gaaatggaga ccttgagggc gattgaggat gccgtattgg acatggaggc
     1261 aatagggaac aaccatctca cgacactcct caaggacaag gacagcctta ctgcatttat
     1321 gaaaacccta gacctagagg aggagaaagc aagaaagcta tcaacgaagt catcctcacc
     1381 agatatcgtc ggcaccatta acgccatact ggctagaata gcagccgcta ggtccctcct
     1441 acacaaggcc aaggaagaga tgtttagcag aattagacca gtagttgtca tgatctcagg
     1501 tagacctggt attggtaaaa cccacatggc aaggcatctg gctaagagta tagccaacac
     1561 aatgaatgga gaccagagag ttggacttgt cccgcgcaac ggggttgacc actgggacgc
     1621 ttacaggggg gagagagtgg tcctgtggga cgactacggt atggggaacc ctgtcaaaga
     1681 tgccttgaca ctgcaagaac tggccgacac ctgtccagtc accttgaact gtgataggat
     1741 tgagaataag gggaagatgt ttgacagtga tgtcatcata atcacgacca atttggtcaa
     1801 ccctgcacct ctcgattatg tgaacttcga ggcttgctcc agaaggattg atttccttgt
     1861 ctatgcagag tcaccagaga tagaaaaggt caagagagac ttccctggtc agcctgatat
     1921 gtggaaagat cacttcaaac cggacttttc ccacataaag ctgactttgg ccccccaggg
     1981 cgggtttgac aagaatggca acaccccaca tggtaaaggc accatgcgtt ctctaaccca
     2041 ggggtctctg actgcaagag tggcgggcct tgttcatgag aggagagatg aattccagct
     2101 gcaaggggat agcctacaga catacaattt tgataccaac agggtctctg cgtttaggaa
     2161 actagccgca gataacaagt atggaatcat ggagacaatg agagtaggtg cggcactcaa
     2221 gaatgtcaag accttggaag acctcagagt tgctttgaga gatgtaaaat tcaatgaatg
     2281 tgagatcatc tacaggaaca ccaagtaccg ggtctcatct gatggtaaag gtacagtctc
     2341 tgttaacaaa gtcgaggacc tcacttccca aaccgcaaac gaggtgagtt cagccctcct
     2401 caggctcaga caagccaggg ccagatatta tgtcagctgc ttccaggacc ttgtctacac
     2461 tctcatacag gttgctgggg cttcatttgt cgtcaacagg atctccaaga ggttctgctg
     2521 ggagagatgg gttaaaccga ccgagaccca ggagacgagt gagcccgaga aggaaactgc
     2581 ccagagtgaa tgggagattg aacccaagga cacagaacca gaaggtaaga agggcaagaa
     2641 caagaaagga aggggcaaga aacacacagc cttctccagt aaaggcctga gtgatgaaga
     2701 gtatgatgag tacaaaagga ttagggaaga aagaaatgga aagtactcca ttgaggaata
     2761 cctccaagac cgtgaccgct actacgaaga agtagcagtt gcccgagcaa cagaggagga
     2821 cttctgtgaa gaggaggagg ccaagataag gcaaagaatc ttccgcccaa caaggaagca
     2881 aagaaaagag gaaaggggtg tgctcggtct ggttactggc acggatatca ggaagagaag
     2941 accggatgac ttccaaccaa agggcaattt gtgggcagat gacactagga gtgtggatta
     3001 caatgagaga cttgatttcg aggccccccc aagcgtgtgg tcaaggatag tcccactggg
     3061 caccggctgg ggcttctggg tctcatccaa cctcctaatt acaacaacac atgtcctgcc
     3121 taagggtatt aaggaactct tcggcgtcga cgtcaaacaa atccaaatcc acaaatctgg
     3181 agaattttgc aggtttagat tcccaaaacc aatcagacca gacgtctcag ggcttgtatt
     3241 ggaagaaggt gcaccagagg gtactgtctg ctccatactc gtgaagagac caacaggtga
     3301 gatgatccct ctagcggtga ggatgggcac gcatgcatct atgaaaatcc agggcaggac
     3361 tgttggtggc caaatgggta tgctcctcac tggggcgaac gcgaagaaca tggacctcgg
     3421 caccggcccg ggagattgcg gttgcccata catttacaag cgcggcaatg acatagtcgt
     3481 ggcaggtgtt cataccgcag cggcccgagg aggcaacact gtcatctgtg ccactcaagg
     3541 gcaggacggg gaagcagttc ttgaagggaa tgagagcctt ggcacttact gtggtgcccc
     3601 aatcctaggt cctggcaagg cgcccaagct cagcacgaag accaagttct ggcgctcatc
     3661 gcctgatgcc ctgccacccg gcacatatga acctgcctac ctaggaggca aagaccccag
     3721 agtagagaag ggaccttccc tgcagcaagt catgagggat cagttgaaac ctttcacaga
     3781 acccaggggc aaaccaccaa gacccacagt cctggaagaa gctaaaaaga cagtaatgaa
     3841 cgtcctggaa cagaccattg accctgctaa accgtggact tactcacaag catgtgcttc
     3901 cttggataag actacttcca gtggcagccc ccatcacatc agaaagaacg accattggaa
     3961 cggagagtct tttacaggcc ccctcgcaga ccaagcatcc aaagctaatc tcatgtatga
     4021 gcaggccaaa cacatgcagc ccgtgtacac agctgcactt aaggatgagc tcgtcaaaac
     4081 tgacaaaatc tacaagaaga taaagaagag gctcctatgg gggtcggacc ttggtacaat
     4141 ggtcaggtgc gccagggcct ttggtggtct catggacagc atgaaagcaa gttgcatagc
     4201 cctcccgtgc agagtgggaa tgaacatgaa tgaggatgga cctatcattt ttgacaagca
     4261 ctctaaatac agataccatt atgatgctga ctactctagg tgggactcaa ctcaacaaag
     4321 aagcatcttg tccgccgcca tggacgtgat ggtgcggttc tctgcggaac cagaattggc
     4381 acaagtagtt gcagaggacc tcttggcacc cagccagctg gacgttggcg actttgtcat
     4441 ctcagttcag gaaggcctgc catcaggagt cccatgtacg tcacaatgga attcaatagc
     4501 ccactggatc ttgaccttga gtgcaatggc agaagtgtca ggcctctcgc cagatgttgt
     4561 gcaagcccat tcctgcttct ctttctatgg tgatgatgag attgtgagca ctgacatcaa
     4621 ccttgaccct tcaaaactga cacagaaact cagggagtat ggtctggtcc ccacccgacc
     4681 tgacaaaact gaaggccccc tggtcataac tgaggacctc accggcctaa cattcctgcg
     4741 caggtcgatc gcgcgggatc ccgctgggtg gtttgggaag ctggaccaag actcaatcct
     4801 cagacagttg tactggacaa gagggcccaa ccatgagaac ccatacgaaa gtatggtccc
     4861 ccattcccag cgggccacac aactcatggc ccttcttgga gaagcctcac tacacggacc
     4921 ccaattctac aagaaggtca gtaagatggt cataagtgag atcaagagtg gtggtctgga
     4981 gttttatgtg cccagacaag aggccatgtt taggtggatg agattctctg acctcagcac
     5041 atgggagggc gatcgcaatc ttgctcccga gagtgtgaat gatgatggcg tcgaatgacg
     5101 ctgctccatc caatgatggt gctgccaacc tcgtaccaga ggccaacaat gaggttatgg
     5161 cacttgaacc ggtggtggga gcctcaattg cagctcctgt cgtcggtcaa caaaatataa
     5221 ttgacccctg gattagagaa aattttgttc aggcaccaca gggtgagttt actgtttcac
     5281 caagaaactc gcctggtgag atgcttttaa atcttgaatt aggcccagag ctcaatcctt
     5341 acctgagtca tttatcccgc atgtataatg gttatgctgg tggcatgcag gttcaggtgg
     5401 tcctagctgg gaatgcgttc acagctggta aaatcatctt tgccgccgtt ccaccacatt
     5461 tccctgtaga gaatattagt gcagcccaaa tcacaatgtg cccccatgtg attgttgatg
     5521 tgagacagct tgagcctgta cttttgcccc ttcctgacat aaggaataga ttctttcact
     5581 acaaccagga agacaccccc cggatgagac ttgtggccat gttgtacaca cctcttagag
     5641 caaactctgg agaggacgtg ttcacagtgt cttgcagggt cttgacccgc ccagcccctg
     5701 actttgagtt cacgttctta gtgccaccaa ccgtagaatc aaagaccaag cctttcacac
     5761 tccctatttt aaccctaggg gaactatcca actccagatt ccctgctcca atagacatgc
     5821 tgtacacaga tcccaatgag acaattgtag tacaaccaca aaatggcaga tgcactctag
     5881 atgggacact ccaagggacc acccagctgg tgcccaccca aatttgctct tttaggggca
     5941 cgttggtcag ccaaacgtcg aggtctgcag attcaacaga ttcagctcca cgggtgagga
     6001 accatcccct tcacgttcag ctgaagaacc ttgacgggac accatatgac ccaacagatg
     6061 aggtaccggc agttctgggt gccatagatt tcaaaggaac tgtgtttgga gtcgctagcc
     6121 agagaaacac cacagggggc tctgtagggg cgacccgtgc ccatgaggtg cacatagata
     6181 ctacaaaccc tagatacacc ccaaaacttg gttctgtgtt gatgtattct gagtctagtg
     6241 attttgatga tggacaaccg actcgcttca cccccatcgg catgggagca gatgattggc
     6301 gccaatggga attgcccgaa tattctggtc accttactct taacatgaac ctagcccccg
     6361 cagttgcccc tgctttcccc ggtgagcgca tcctcttctt caggtcagtg gttccatctg
     6421 ctggtggtta cggatcagga caaatagact gcctcatccc acaggagtgg gttcagcact
     6481 tctaccagga ggccgcccca tcacaatctg cggtggctct tattagatat gttaaccctg
     6541 acactgggag aaacatcttt gaggcaaagc tacatagaga agggttcatc actgtggcaa
     6601 attctggaaa caaccccata gtcgtgcccc caaatggtta tttcaggttt gaggcctggg
     6661 tcaatcaatt ttacacactc acccccatgg gaactggaca ggggcgtagg agagtccaat
     6721 aatggcagga gccttctttg ctggattagc aggcgacgcc ataacaaatg gtgtcgggtc
     6781 cctgattaac gctggggcca acgcaatcaa tcagaaggta gagtatgatt tcaacaaaca
     6841 actccaattg gcatccttta aacatgacaa ggaaatgcta caatcacaag ttctggccac
     6901 caaacagctc cagcaggaaa tgatgaatat aaggcaaggg gtcttgaccg ctggcggctt
     6961 ttcccctaca gatgccgcga gaggcgctgt aaacgcgcca atgacaaaga ttctggattg
     7021 gaatggcaca agatattttg ctccaaatag tatgaaaaca accagttatt caggtcagtt
     7081 ttccagtaat cctgtgcata ggcaacccac tttgtcccgt cctgattccc aaaaagtcaa
     7141 aattaatagt gattctgcta gtatatatag ttctatgtct actgctcctt cacaatcaac
     7201 ccattcaatg attctgactt cagggtctgg atcgtccagg acaacctcct ctcccacagt
     7261 gacttccacc ctatctagga ccagtgactg ggtgaggggg caaaatgaga ggcttagccc
     7321 gttcatggat ggtgctctcc aaacgacttt tgtcacacca ccatcgagca gagcttcatc
     7381 aaatgggtcg gtctcaaccg ttcccaaagc tgttttggac tcctggactc ctatgtttaa
     7441 cacccatagg cagcctctct tcgctcactt gcgtaggcga ggggagtcac aagtttagtg
     7501 aaaagattga ttaggttttc ttctcccttc tttctccttt ttctttt
//