Typing tool

Complete norovirus genomes

HQ009513  GII.4 New Orleans
 GII.P4 Hunter

Length: 7,558 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       HQ009513                7558 bp    RNA     linear   VRL 05-SEP-2010
DEFINITION  Norovirus Hu/GII.4/JB-15/KOR/2008, complete genome.
ACCESSION   HQ009513
VERSION     HQ009513.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/JB-15/KOR/2008
  ORGANISM  Norovirus Hu/GII.4/JB-15/KOR/2008
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7558)
  AUTHORS   Jang,K.M., Oh,T.K., Kim,C.H. and Choi,C.W.
  TITLE     Complete nucleotide sequence of human norovirus JB-15 isolated from
            Korea
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7558)
  AUTHORS   Jang,K.M., Oh,T.K., Kim,C.H. and Choi,C.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-AUG-2010) Biology, Pai Chai University, 14 Yeon-ja
            1Gil Seo-gu, Daejeon, Chungnam 302-735, Korea
FEATURES             Location/Qualifiers
     source          1..7558
                     /organism="Norovirus Hu/GII.4/JB-15/KOR/2008"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/JB-15/KOR/2008"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:880562"
                     /country="South Korea"
                     /collection_date="2008"
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ADM52742.1"
                     /translation="MKMASNDASAAAVANSNNDTVKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQGPPRPPTPELIKNIPPPPPNGEDDIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELTPLSLYWRPVYTPQYLISPDALKRLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVRTM
                     PELKQALKNISIKKCQIVYSGSTYTLESDGKGNVKVDRVQSASVQTNNELAGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQSLWSKPQVENTEETTSKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     RYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAEIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLHTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLAISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGS
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="ORF2; VP1"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="ADM52743.1"
                     /translation="MKMASNDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLATQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRADGSTRGHKATVYTGSADFAPKLGRVQFATDTDNDFDANQNTKFTPVGVIQDG
                     NTAHRNEPQQWVLPSYSGRNSHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="ORF3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ADM52744.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGHFSTPQPSGALPGRANLRAAVPARGSSSTSS
                     NSSTATSVYSNQTTSTRLGSTAGSGTSVSSLPSTARARSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaata gcaacaacga
       61 caccgtaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt tcaaacgagc
      121 cctcggggcg cggcctaaac agcctccccc gagggaaata ccacaaggac ccccacgacc
      181 acccactcca gaactgatca aaaatatccc ccctcctcca cccaacggag aggatgacat
      241 agtggtttct tatagtgtca aagatggtgt ctctggtttg cctgatcttt ccaccgtcag
      301 gcaaccggaa gaatctaata cggccttcag tgtccctcca ctcaatcaga gggagaatag
      361 agatgctaag gaaccactga ctggaacaat tttggaaatg tgggatggag aaatctatca
      421 ttatggcctg tatgtagagc gaggtcttgt gctaggtgtg cacaaaccac cagctgccat
      481 cagcctcgcc agggtcgaac taacaccact ttccttgtac tggagacctg tgtatactcc
      541 ccagtacctc atctctccag acgctctcaa gagactacac ggagagacgt tcccctatac
      601 agcctttgac aacaactgct acgccttttg ttgttgggtc ctggacctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgactc caagttaaag aaggtagcta acatattcct
      781 gtgtgcactg tcttcgctat tcaccaggcc tataaaagat ataataggga agctaaggcc
      841 tcttaacatc cttaacatct tggcctcatg tgattggact tttgcaggca tagtggagtc
      901 cttgatactc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg actacgagct acagggacct gaggaccttg cagtggagct
     1021 cgtccctgta gtgatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catccacctt gagagcttgt aaagatcttg gtgcatatgg
     1141 gctagagatc ctaaagttgg ttatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctata gtgagatcca tcgaggatgc agtcctggat ctcgaagcaa ttgaaaacaa
     1261 ccatatgacc actttgctca aagacaaaga cagtctggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcca ggaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc tgctgcacgt tctctggtgc atcgagcgaa
     1441 ggaggaactt tctagcagac caagacctgt agtgttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcca gggaagtggc taagagaatc gcagcctccc ttacaggaga
     1561 ccagcgtgta ggcctcgtcc cacgcaatgg cgtcgaccat tgggatgcgt acaaggggga
     1621 gagggtcgtt ctatgggacg actatggaat gagcaatcct atccacgatg ccctcagatt
     1681 gcaagaactc gctgacactt gtcccctcac cctaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagcgatg tcatcattat caccactaat ctggctaacc cagcaccact
     1801 ggactatgtc aacttcgaag catgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccctgaggtc gaaaaggcga agcgtgactt cccaggccaa cccgacatgt ggaagaacgc
     1921 cttcagttct gatttctcac acataaaact aacattggct ccacagggtg gtttcgacaa
     1981 gaacgggaac accccacacg ggaagggcgt catgaagact ctcaccaccg gctccctcat
     2041 tgcccgggca tcagggctac tccatgagag gctagatgaa tttgaactac agggcccaac
     2101 tctcaccact ttcaactttg atcgcaataa agtgcttgcc tttagacaac ttgctgctga
     2161 aaacaaatat gggttgatgg acacaatgaa agttgggagg cagctcaagg atgtcagaac
     2221 aatgccagag ctcaagcaag cactcaagaa tatttcaatc aagaagtgcc agatagtgta
     2281 tagtggtagc acctacacac ttgagtctga tggcaagggt aatgtgaagg ttgacagagt
     2341 tcaaagcgcc tccgtgcaga ccaacaatga gctggctggc gccctacacc atctaaggtg
     2401 cgccagaata agatactatg tcaggtgtgt ccaggaggcc ctgtattcca tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aaagcctatg
     2521 gtctaagcca caagtggaaa atacagagga gactaccagc aaggacgggt gtccaaaacc
     2581 caaagatgat gaggagttcg tcatttcatc cgacgacatc aaaactgagg gcaagaaagg
     2641 gaaaaacaag actggccgcg gtaagaagca cacagccttc tcaagcaaag gtctcagtga
     2701 tgaagagtac gatgagtaca agaggattag agaagaaagg aatggtaggt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgactga
     2821 ggaagacttc tgtgaagagg aggaggccga gatccggcaa aggatcttca ggccgacaag
     2881 gaaacaacgc aaggaggaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 aagaaatcca gatgatttca aacccaaggg gaaactgtgg gctgacgatg acagaagtgt
     3001 ggactacaat gagaaactca gttttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggat tctgggtctc ccccagtttg ttcataacat caacccatgt
     3121 cataccccag ggagcaaagg agttctttgg agtccccatc aaacaaattc aggtacataa
     3181 gtcaggcgaa ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcac ccgagggcac cgtggttaca ctactcatca aaaggtccac
     3301 tggggaactc atgcccctag cagctaggat ggggacccat gcaaccatga gaatccaagg
     3361 acgcactgtt ggaggtcaaa tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 tctgggtacc acaccaggtg attgtggctg tccctacatc tacaagagag gaaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtgggggc aacactgtca tatgtgccac
     3541 ccaggggagt gagggagagg ctacacttga aggtggtgac aataaaggga catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaagacca aattctggag
     3661 atcgtccaca gcaccactcc cacctggcac ctatgaacca gcctatcttg gtggtaagga
     3721 tcccagagtc aagggtgggc cttcactaca gcaggtcatg agggatcagc tgaagccatt
     3781 cacagagccc aggggtaagc caccaaagcc aagtgtgttg gaagctgcta agaaaaccat
     3841 catcaatgtc cttgagcaaa caattgatcc acctgagaaa tggtcgttcg cacaagcttg
     3901 cgcgtccctt gataagacca cctccagcgg ccatccgcat cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgacgccagt ctatacagct gcgcttaagg atgaattagt
     4081 taaaactgac aaaatttatg gcaagattaa gaagaggctt ctctggggct cggatttggc
     4141 gaccatgatc cggtgtgctc gagcattcgg aggcctgatg gatgaactca aagcgcactg
     4201 tgtcacactt cccattagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaggcactcc aggtacacgt accactatga tgctgattac tctcgatggg attcaacaca
     4321 acagagagcc gtgttggcag cagctctaga aatcatggtt aagttctccc cagaaccaca
     4381 tttggcccag gtagtcgcag aagaccttct ttctcctagc gtggtggacg tgggtgactt
     4441 cacaatatca attaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttcaca ccctctgtgc gctctctgaa gttacaaact tgtctcctga
     4561 caccatacaa gctaattccc tcttctcttt ttatggtgat gatgaaattg ttagcacaga
     4621 cataaaattg gacccagaaa agttgacagc aaagctcagg gaatatgggt taaaaccaac
     4681 ccgccccgac aaaactgaag gaccccttgc catctctgaa gacttgaatg gcctgacttt
     4741 cttgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg ttccaaccat gaagacccat ctgaaacaat
     4861 gattccacac tcccaaagac ccatacaact gatgtcccta ctgggggagg ccgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa gttagtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ccattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaacaatt ttgtacaagc ccctggtgga gagttcacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatttga
     5341 atccctacct ttcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccggaaaaat catatttgcg gcagtcccac
     5461 caaatttccc aactgaaggc ttgagcccca gccaggtcac tatgttcccc cacataatag
     5521 tagatgttag gcaactggaa cctgtgttga tccccttacc cgatgttagg aataatttct
     5581 atcactataa tcaatcaaat gaccccacca tcaaattgat agcaatgttg tatacaccac
     5641 ttagggctaa taatgctggg gacgatgtct tcacagtttc ttgtcgggta ctcacgagac
     5701 catcccccga ttttgatttc atatttttag tgccacccac agttgaatca agaactaaac
     5761 cattctctgt cccaatttta actgttgagg agatgaccaa ttcaagattc cccattcctt
     5821 tggaaaagct gttcacgggt cccagcagtg cctttgttgt tcaaccacaa aacggcaggt
     5881 gcacgactga tggcgtgctc ctaggtacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccat attacaggta gtcgtaacta cacaatgaat ttggctactc
     6001 aaaattggaa cagttatgac ccaacagaag aaatcccagc ccctctagga actccagatt
     6061 tcgtgggaaa gatccaaggt gtgctcaccc aaaccacgag ggcagatggc tcgacccgtg
     6121 gccacaaagc tacagtgtac actgggagcg ccgactttgc tccaaaactg ggtagagttc
     6181 aatttgccac cgacacagac aatgattttg atgctaacca aaacacaaag ttcaccccag
     6241 tcggtgtcat ccaggatggt aatactgccc accgaaatga accccaacaa tgggtgctcc
     6301 caagttactc aggcagaaat agtcacaatg tgcacctggc ccccgctgta gcccccactt
     6361 ttccgggtga gcaacttctc ttcttcagat ccactatgcc cggatgcagc gggtacccca
     6421 acatggactt ggactgtctg ctcccccagg aatgggtgca gtatttctat caagaggcag
     6481 ccccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg taagcttcat aaatcaggct atgttacagt ggctcacacc ggccaacatg
     6601 atttggttat cccccccaat ggttatttca gatttgattc ctgggtcaac cagttctaca
     6661 cacttgcccc catgggaaat ggaacggggc gtagacgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg acgtccttgg atccggactt ggttctctga tcaatgccgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaataac agaaaattgc aacaagcttc
     6841 cttccaattt agtagcaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagttgca acaggaaatg atgagagtta aacaggcaat
     6961 gctcctagag ggtggattct ctgagacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaggct ttggactgga gtgggacaag gtactgggct cccgatgcta ggactacaac
     7081 atacaatgca ggccactttt ccacccctca accctcgggg gcactgccag ggagagctaa
     7141 tcttagggct gctgtccccg ctcggggctc ctccagcaca tcttctaact cttctactgc
     7201 tacctctgtg tactcaaatc aaactacttc aacgagactt ggttctacag ctggttctgg
     7261 tactagtgtc tcgagcctcc cgtcaactgc aagggctagg agctgggttg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgccc aaagaagttt tggactcctg
     7441 gactggcgct ttcaatacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt cttttcttta gtgtctcc
//