Typing tool

Complete norovirus genomes

HM748973  GII.4 Yerseke
 GII.P4 Hunter

Length: 7,560 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       HM748973                7560 bp    RNA     linear   VRL 10-MAY-2013
DEFINITION  Norovirus Hu/GII.4/Turramurra/NSW892U/2009/AUS, complete genome.
ACCESSION   HM748973
VERSION     HM748973.2
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Turramurra/NSW892U/2009/AUS
  ORGANISM  Norovirus Hu/GII.4/Turramurra/NSW892U/2009/AUS
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7560)
  AUTHORS   Eden,J.S., Tanaka,M.M., Boni,M.F., Rawlinson,W.D. and White,P.A.
  TITLE     Recombination within the Pandemic Norovirus GII.4 Lineage
  JOURNAL   J. Virol. 87 (11), 6270-6282 (2013)
   PUBMED   23536665
REFERENCE   2  (bases 1 to 7560)
  AUTHORS   Eden,J.-S., Bull,R.A., Lim,H.F. and White,P.A.
  TITLE     Emergence of a New Pandemic Norovirus Variant of the GII.4 Lineage
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7560)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUL-2010) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
REFERENCE   4  (bases 1 to 7560)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
  REMARK    Sequence update by submitter
COMMENT     On Feb 6, 2012 this sequence version replaced HM748973.1.
FEATURES             Location/Qualifiers
     source          1..7560
                     /organism="Norovirus Hu/GII.4/Turramurra/NSW892U/2009/AUS"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/NSW892U/2009/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:925747"
                     /country="Australia"
                     /collection_date="2009"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ADQ43782.2"
                     /translation="MKMASNDASAAAVANSNNDTVKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKNIPPPPPNGEDDIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELTPLSLYWRPVYTPQYLISPDALKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLVPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLTLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPTLTTFNFDRNKVLAFRQLAAENKYGLMDTMKIGRQLKDVRTM
                     PELKQALKNISIKKCQIVYSGSTYTLESDGKGNVKVDRVQSASVQTNNELAGALHHLR
                     CARIRYYVRCVQEALYSIIQIAGAAFVTTRIVKRMNIQNLWSKPQVENTEETTSKDGC
                     PKPKDDEEFVISSDDIKAEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLAISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGS
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ADQ43783.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHITGSRNYTMNLATQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRADGSTRGHKATVYTGSADFAPKLGRVQFATDTDNDFDANQNTKFTPVGVIQDG
                     DTAHRNEPQQWVLPSYSGRNSHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="AEZ56475.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKVLDWSGTRYWAPDARTTTYNAGHFSTPQPSGALPGRANFRAAVPARGSSSIPS
                     NSSTTTSVYSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
     3'UTR           7514..7560
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaata gcaacaacga
       61 caccgtaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt tcaaacgagc
      121 cctcggggcg cggcctaaac agcctccccc gagggaaata ccacaaagac ccccacgacc
      181 acctactcca gaactggtca aaaatatccc ccccccccca cccaacggag aggatgacat
      241 agtggtttct tatagtgtca aagatggtgt ctctggtttg cctgatcttt ccaccgtcag
      301 gcaaccggaa gaatctaata cggctttcag tgtccctcca ctcaatcaga gggagaatag
      361 agatgctaag gagccactga ctggaacaat tttggaaatg tgggatggag aaatctatca
      421 ttatggcctg tatgtagagc gaggtcttgt gctaggtgtg cacaaaccac cagctgccat
      481 cagcctcgct agggtcgaac taacaccact ctccttgtac tggagacctg tgtatactcc
      541 ccagtacctc atctccccag acgctctcaa gaaactacac ggagagacgt tcccctacac
      601 agcctttgac aacaactgct atgccttttg ctgttgggtc ctggacttaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgactc caagttaaag aaggtagcta acatattcct
      781 gtgtgcactg tcttcactat tcaccaggcc tataaaagat ataataggga agctaaggcc
      841 tcttaacatc ctcaacatct tggcctcatg tgattggact tttgcaggca tagtggagtc
      901 cttgatactc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg actacgagct gcagggacct gaggaccttg cggtggagct
     1021 cgtccctgta gtgatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catccacctt gagagcttgt aaagatctcg gtgcatacgg
     1141 gctggagatc ctaaagttgg tcatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctata gtgagatcca tcgaggatgc agtcctagat ctcgaagcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagtctggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcca ggaaactctc aaccaagtct gcttcacctg acattgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc tgctgcacgt tctctggtgc atcgagcgaa
     1441 ggaggaactt tctagcagac caagacctgt agtgttgatg atatcaggca ggccaggaat
     1501 agggaagacc caccttgcca gggaagtggc taagagaatc gcagcctccc ttacaggaga
     1561 ccagcgtgta ggcctcgtcc cacgcaatgg cgtcgaccat tgggatgcgt acaaggggga
     1621 gagggtcgtt ctatgggacg actatggaat gagcaatccc atccacgatg ccctcagatt
     1681 gcaagaactc gctgacactt gtcccctcac cctaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagcgatg tcatcattat caccactaat ctggccaacc cagcaccact
     1801 ggactacgtc aactttgaag cttgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccctgaggtc gaaaaggcga agcgtgactt cccaggccaa cccgacatgt ggaagaacgc
     1921 cttcagttct gatttctcac acataaaact aacattggct ccacagggtg gtttcgacaa
     1981 gaacgggaat accccacacg ggaagggcgt catgaagact ctcaccaccg gctcccttat
     2041 tgcccgggcg tcagggctac tccatgagag gctagatgaa tttgaactac agggcccaac
     2101 tcttaccacc ttcaactttg atcgcaataa agtgcttgcc tttagacaac ttgctgctga
     2161 aaacaaatat gggttgatgg acacaatgaa aattgggagg cagctcaagg atgtcagaac
     2221 aatgccagag ctcaagcaag cactcaagaa tatttcaatc aagaagtgcc agatagtgta
     2281 tagtggtagc acctacacac ttgagtctga tggcaagggc aatgtgaagg ttgacagagt
     2341 tcaaagcgcc tctgtgcaga ccaacaatga gctggctggc gccctacacc atctaaggtg
     2401 cgccagaata agatactatg tcaggtgtgt ccaggaggcc ctgtattcca tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aaaacctatg
     2521 gtctaagcca caagtggaaa atacagagga gactaccagc aaggacgggt gtccaaaacc
     2581 caaagatgat gaggagttcg tcatttcatc cgacgacatc aaagctgagg gcaagaaagg
     2641 gaaaaacaag actggccgcg gcaagaagca cacagccttc tcaagcaagg gtctcagtga
     2701 tgaagagtac gatgagtaca agaggattag agaagagagg aatggtaagt actccataga
     2761 agagtacctt caggacagag acagatacta tgaggaggtg gccattgcca gggcgactga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttca ggccaacaag
     2881 gaaacaacgc aaggaggaaa gagcttctct tggtttagtc acaggttctg aaattaggaa
     2941 aagaaatcca gatgatttca aacccaaggg gaaactgtgg gctgacgatg acagaagtgt
     3001 ggactataat gagaaactca gttttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ctttggttca ggttggggat tctgggtttc ccccagtttg ttcataacat caacacatgt
     3121 cataccccag ggagcaaagg agttctttgg agtccccatc aagcaaattc aggtacataa
     3181 gtcaggcgaa ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggtgcac ccgagggcac cgtggttaca ttactcatca aaaggtccac
     3301 tggagaactc atgcccctag cagctaggat ggggacccat gcaaccatga gaatccaagg
     3361 acgcactgtt ggaggtcaaa tgggcatgct tctgacagga tccaacgcca agagcatgga
     3421 tctgggtacc acaccaggtg attgtggttg tccctacatc tacaagagag gaaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggaggc aacactgtca tatgtgccac
     3541 ccaggggagc gagggagagg ctacacttga aggtggtgac aataaaggga catactgtgg
     3601 tgcaccaatc ctaggcccag gaagtgcccc aaaacttagc accaagacca aattctggag
     3661 atcgtccaca gcaccactcc cacctggcac ctatgaacca gcctatcttg gtggtaagga
     3721 ccccagagtc aagggtggac cttcactgca gcaggtcatg agggatcagc tgaagccttt
     3781 cacagagccc aggggcaagc caccaaagcc aagtgtgttg gaagctgcta agaaaaccat
     3841 catcaatgtc cttgagcaaa caattgatcc acctgagaaa tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacca cctccagtgg ccacccgcat cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca caggcaagct tgcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagag gggaagaaca tgacgccagt ctatacagct gcgcttaagg atgaattagt
     4081 taaaactgac aaaatttatg gcaagatcaa gaagaggctt ctctggggct cggatttggc
     4141 gaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcgcactg
     4201 tgtcacactt cccattagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gagacactcc aggtacacat accactatga tgctgattac tctcgatggg attcaacaca
     4321 acagagagcc gtgttggcag cagctctaga aatcatggtt aagttctccc cagaaccaca
     4381 tctggcccag gtagtcgcag aagaccttct ttctcctagc gtggtggacg tgggtgactt
     4441 cacaatatca attaacgagg gtcttccttc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ccctctgtgc gctctctgaa gttacaaact tgtctcctga
     4561 caccatacaa gctaattccc tcttctcttt ttatggtgat gatgaaattg ttagcacaga
     4621 cataaaattg gacccagaaa agttgacagc aaagctcagg gaatatgggt taaagccaac
     4681 ccgccccgac aaaactgaag gaccccttgc catctctgaa gacttgaatg gcctgacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg ttccaaccat gaagacccat ctgaaacaat
     4861 gattccacac tcccaaagac ccatacaact gatgtcccta ctgggggagg ccgcactcca
     4921 cggcccagca ttctacagca aaatcagcaa gttagtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggcgccg ctattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc tcctggtgga gagttcacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatttga
     5341 atccctacct ttcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccggaaaaat catatttgca gcagtcccac
     5461 caaatttccc aactgaaggc ttgagcccca gccaggtcac tatgtttccc catataatag
     5521 tagatgttag gcaattggaa cctgtgttga tccccttacc cgatgttagg aataatttct
     5581 atcactacaa tcaatcaaat gaccccacca tcaaattgat agcaatgttg tatacaccac
     5641 ttagggctaa taatgctggg gacgatgtct tcacagtttc ttgtcgggtt ctcacgagac
     5701 catcccccga ttttgatttt atatttttag tgccacccac agttgagtca agaactaaac
     5761 cattctctgt cccaatttta actgttgagg agatgaccaa ttcaagattc cccattcctt
     5821 tggaaaagct gttcacgggt cccagcagtg cctttgttgt tcaaccacaa aacggcaggt
     5881 gcacgactga tggcgtgctc ctaggtacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga cgtcacccat attacaggca gtcgtaatta cacaatgaat ttggctactc
     6001 aaaactggaa cagttatgac ccaacagaag aaatcccagc ccctctagga actccagatt
     6061 tcgtggggaa gattcaaggt gtgctcaccc aaaccacaag ggcagatggc tcgacccgcg
     6121 gccacaaagc tacagtgtac actgggagcg ccgattttgc tccaaaactg ggtagagttc
     6181 aatttgccac tgacacagac aatgattttg atgctaacca aaacacaaaa ttcaccccag
     6241 tcggtgtcat ccaggatggt gatactgccc accgaaatga gccccaacaa tgggtgctcc
     6301 caagttactc aggcagaaat agtcacaatg tgcacctggc ccccgctgta gcccccactt
     6361 ttccgggtga gcaactcctc ttcttcagat ccactatgcc cggatgcagc gggtacccta
     6421 acatggattt ggactgtctg ctccctcagg aatgggtaca gtatttctat caagaggcag
     6481 ccccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg taagcttcat aaatcaggct atgttacagt ggctcacacc ggccaacatg
     6601 atttggttat cccccccaat ggttatttta gatttgattc ctgggtcaac cagttctaca
     6661 cacttgcccc catgggaaat ggaacggggc gtagacgtgc tttataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg acgtccttgg ctccggactt ggttctctga tcaatgccgg
     6781 ggctggggcc atcaatcaaa aagttgaatt tgaaaataac agaaaattgc aacaagcttc
     6841 cttccaattc agcagcaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagttgca acaggaaatg atgagagtta aacaggcaat
     6961 gctcctagag ggtggattct ctgagacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaggtt ttggactgga gtgggactag gtactgggct cccgatgcta gaactacaac
     7081 atacaatgca ggccactttt ccacccctca accctcgggg gcactgccag gaagagctaa
     7141 ttttagggct gctgtccccg ctcggggctc ctctagcata ccttctaact cttctactac
     7201 tacttctgtg tattcaaatc aaaccacttc aacgagactt ggttctacag ctggttctgg
     7261 taccagtgtc tcgagcctcc cgtcaactgc aaggactagg agctgggttg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgccc aaagaagttt tggactcctg
     7441 gactggcgct ttcaatacgc gcaggcagcc tctcttcgct cacattcgta agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt ctttcttttt agtgtctttt
//