Typing tool

Complete norovirus genomes

HM748971  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,560 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       HM748971                7560 bp    RNA     linear   VRL 10-MAY-2013
DEFINITION  Norovirus Hu/GII.4/Beecroft/NSW305P/2009/AUS, complete genome.
ACCESSION   HM748971
VERSION     HM748971.2
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Beecroft/NSW305P/2009/AUS
  ORGANISM  Norovirus Hu/GII.4/Beecroft/NSW305P/2009/AUS
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7560)
  AUTHORS   Eden,J.S., Tanaka,M.M., Boni,M.F., Rawlinson,W.D. and White,P.A.
  TITLE     Recombination within the Pandemic Norovirus GII.4 Lineage
  JOURNAL   J. Virol. 87 (11), 6270-6282 (2013)
   PUBMED   23536665
REFERENCE   2  (bases 1 to 7560)
  AUTHORS   Eden,J.-S., Bull,R.A., Lim,H.F. and White,P.A.
  TITLE     Emergence of a New Pandemic Norovirus Variant of the GII.4 Lineage
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7560)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JUL-2010) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
REFERENCE   4  (bases 1 to 7560)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
  REMARK    Sequence update by submitter
COMMENT     On Feb 6, 2012 this sequence version replaced HM748971.1.
FEATURES             Location/Qualifiers
     source          1..7560
                     /organism="Norovirus Hu/GII.4/Beecroft/NSW305P/2009/AUS"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/NSW305P/2009/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:925745"
                     /country="Australia"
                     /collection_date="2009"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ADQ43778.2"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAATFKRTLGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEVVVSYSAKNGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATNKDGC
                     PKPKDNEEFVISSDDIKAEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDRYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKDGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ADQ43779.1"
                     /translation="MKMASNDASPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     GTTHRNEPQQWALPSYSGRNVQNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="AEZ56473.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFFETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTLQPSGALPGRISPRTPTPARGSPSISS
                     NASTATSIYSNQTVSTRLGSTAGSGTNVSSLPSTARTRSWVEDQNRDLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWAGAFNTRRQPLFAHIRRRGESRV"
     3'UTR           7514..7560
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acaaaatgtt ttctagcatg gctgccactt ttaaacgaac
      121 cctcggggcg cggcctaaac agcccccccc gagggaaata ccacaaagac ccccacgacc
      181 acctactcca gaactggtca aaaagatccc tcctcccccg cccaacgggg aggacgaagt
      241 agtggtttct tatagtgcca aaaatggcgt ttccggttta cctgagcttt ccaccgtcag
      301 gcaaccggaa gaaaccaaca cggccttcag cgtccctcca ctcaatcaga gggagaatag
      361 ggatgctaag gaaccactga ctggaacaat tctggaaatg tgggatggag agatctacca
      421 ttatggcctg tatgttgagc gaggtcttgt gctgggtgtg cacaaaccac cagctgccat
      481 tagcctcgcc aaggtcgaac taacaccact ctctttgttc tggagacctg tgtacacccc
      541 tcagtacctc atctctccag acactctcaa gaaattacac ggagaaacat ttccctacac
      601 agccttcgac aacaattgct atgccttttg ttgctgggtc ctggatctaa acgactcgtg
      661 gctgagtagg agaatgatcc aaagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgattc taagttaaag aaggtagcta acatattcct
      781 gtgcaccctg tcttcgctat tcaccaggcc cataaaagac ataataggga agttaaggcc
      841 tctcaacatc atcaacatcc tggcttcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ttggcagagc tctttggagt cttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg atttcgagtt acaaggacct gaggaccttg tagtagagct
     1021 cgtccctgta gtaatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catctaccct gagagcttgt aaagatcttg gtgcgtatgg
     1141 gctagagatc ctaaagttag tcatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtactggac cttgaggcaa ttgaaaacaa
     1261 ccatatgacc accctgctca aagataaaga cagcctggca acctatatga gaacccttga
     1321 cctcgaggaa gagaaggcca gaaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc cgctgcacgc tccctggtgc accgagcgaa
     1441 ggaggagctt tccagcagac caagacctgt agtcttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc tcacaggaga
     1561 ccagcgtgta ggcctcatcc cacgcaatgg cgtcgaccac tgggacgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagcaatccc atccacgacg ccctcaggct
     1681 acaagaactc gctgacactt gccccctcac tctaaattgt gacaggattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcatcattat cactactaac ctggccaacc cagctccact
     1801 ggactatgtc aactttgaag cgtgctcgag gcgcatcgat ttcctcgtgt atgcagaagc
     1861 ccccgaggtc gaaaaagcga agcgtgactt cccgggccaa cctgacatgt ggaaaaacgc
     1921 ttttagtcct gatttctcac acataaaatt ggcattggct ccacaaggtg gctttgacaa
     1981 gaacgggaac accccacacg ggaagggcgt tatgaagact cttaccactg gctctctcat
     2041 tgcccgggca tcagggctgc tccatgagag actggatgag tttgaactac agggcccagc
     2101 tcttaccacc ttcaactttg accgcaacaa agtgctcgcc ttcaggcagc ttgctgctga
     2161 aaacaaatac gggttgatgg acacaatgaa ggttgggagg cagctcaagg atgtcaaaac
     2221 catgccagaa cttaaacaag cactcaagaa tatctcaatc aagaagtgcc agattgtgta
     2281 tagtggttgc acctacacac ttgagtctga tggcaagggc aatgtgaaag ttgacagggt
     2341 tcagagcacc tccgttcaga ccaacaatga gctggctggc gccctgcacc atctaaggtg
     2401 cgctagaatc aggtactatg tcaagtgtgt ccaggaggcc ctgtattcta tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat catcaagcgt gttaacatcc aagacttatg
     2521 gtccaagcca caagtggaaa acacagagga ggccaccaac aaggacgggt gcccaaaacc
     2581 caaagataat gaggagttcg tcatttcatc tgacgacatt aaagctgagg gtaagaaggg
     2641 gaagaacaag actggccgtg gcaagaagca cacagccttc tcaagtaaag gtctcagtga
     2701 tgaagagtat gatgagtaca agagaattag agaggaaagg aatggcaagt actccataga
     2761 agagtacctt caggacaggg acagatacta tgaggaggtg gccattgcta gggcgaccga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttca gaccaacaag
     2881 gaaacaacgc aaggaagaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 aaggaaccca gaagacttca agcctaaggg gaaactatgg gctgacgatg acagaagtgt
     3001 ggactacaat gaaaaactca gctttgaggc cccaccaagc atctggtcaa ggatagtcaa
     3061 ctttggctca ggttggggct tctgggtctc ccccagcctg ttcataacat caacccacgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaattc aggtacacaa
     3181 gtcaggcgaa ttttgtcgct tgaggttccc aaaaccaatc aggactgatg tgactggcat
     3241 gatcttggaa gaaggtgcac ccgaaggcac cgtggtcaca ctactcatca aaaggtctac
     3301 tggagaactc atgcccctag cagctagaat ggggacccat gcaaccatga aaattcaggg
     3361 gcgcactgtt ggaggtcaga tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 tctaggcacc acaccaggtg attgcggctg tccctacatc tacaagagag gaaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 ccaggggggt gaaggggaag ctacacttga aggtggtgac agtaagggaa catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaaaacca aattctggag
     3661 atcatccaca gcaccactcc cacctggcac ctatgaacca gcctaccttg gtggcaagga
     3721 ccccagagtc aaggatggcc cctcgttgca gcaagtcatg agggaccagc tgaaaccatt
     3781 tacagagcct aggggtaagc caccaaagcc aagcgtgtta gaagctgcca agaaaaccat
     3841 catcaatgtc cttgaacaaa caattgaccc acctgagaag tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttctagcgg ccatccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca cgggtaagct agcagaccag gcttccaagg ccaatctgat
     4021 gtttgaagaa gggaagaaca tgaccccagt ctacacaggt gcacttaagg atgaattagt
     4081 caaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct cggatttagc
     4141 aaccatgatc cggtgtgctc gagcattcgg aggcttaatg gatgagctca aagcacactg
     4201 tgtcacactt cctatcagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaagcattcc aggtacagat accactatga tgctgattac tctcggtggg attcaacaca
     4321 acagagagcc gtgctggcag ccgctctaga aatcatggtt aaattctcct cagaaccaca
     4381 tttggctcag gtagtagcag aagaccttct ttctcctagc gtggtggatg taggtgactt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc actctccgaa gttacaaatt tgtccccaga
     4561 catcatacag gctaattctc tcttctcctt ctatggtgat gatgaaattg ttagtacaga
     4621 cataaaatta gacccagaga agttgacagc aaagcttaag gaatacgggt tgaaaccaac
     4681 ccgccctgat aaaactgaag gacctcttgt tatttctgaa gacttagatg gtttgacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagctc
     4801 aatactcagg caaatgtact ggactagggg ccccaaccat gaagatccat ctgaatcaat
     4861 gattccacac tctcaaagac ccatacaatt gatgtcctta ctgggagagg ccgcactcca
     4921 cggcccaaca ttctacagta aaatcagcaa attggttatt gcagagctaa aagaaggtgg
     4981 tatggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccag cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gtcggtgccg ctattgcggc gcctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaacaatt ttgtacaagc ccctggtgga gagttcacag
     5281 tgtcccccag aaacgctcca ggtgaaatat tatggagcgc gcccttaggc cctgatctga
     5341 atccctacct atctcatttg gccagaatgt ataatggtta tgcaggtggc tttgaagtgc
     5401 aggtgatcct cgcggggaac gcgttcaccg ccggaaaaat tatatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ttgagtccca gccaggtcac tatgttcccc cacataatag
     5521 tggatgttag gcaattggaa cctgtgttga tccccttacc tgatgttagg aataacttct
     5581 atcactataa tcagtcaaat gattctacca ttaaattgat agcaatgctg tatacaccac
     5641 ttagggctaa taacgctggg gaagatgtct tcacagtctc ttgtcgagtt ctcacgaggc
     5701 catcccctga ttttgatttt atatttttgg tgccacctac agttgagtca agaactaaac
     5761 catttactgt cccaatctta actgttgaag aaatgaccaa ctcaagattc cccattcctt
     5821 tggaaaaatt gttcacgggt cccagcagtg cctttgttgt tcaaccacaa aatggcagat
     5881 gcactactga tggcgtgctc ttaggcacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac attgcaggtt ctcgtaatta cacaatgaat ttggcttctc
     6001 taaattggaa caattatgac ccaacagaag aaattccagc ccctctagga actccagatt
     6061 tcgtgggaaa gatccaaggt gtgctcaccc aaaccacaaa gggagatggc tcgacccgtg
     6121 gccataaagc tacagtttat actgggagtg ccccctttac tccaaagctg ggcagtgttc
     6181 aattcagtac tgatacagaa aatgattttg aaactcacca aaacacaaaa ttcaccccag
     6241 tcggcgtcat ccaggatggt ggcaccaccc accgaaatga accccaacaa tgggcgctcc
     6301 caagttattc aggtagaaat gtccagaatg tacacctagc ccctgctgta gcccccactt
     6361 ttccgggtga acaacttctt ttctttaggt ccactatgcc cggatgcagc gggtacccca
     6421 acatggattt ggattgccta ctcccccagg agtgggtgca gcacttctac caagaggcag
     6481 ctccagcaca atctgatgtg gctctattga gatttgtgaa tccagacacg ggtagggtcc
     6541 tgtttgagtg taaacttcat aaatcaggct atgtcacagt ggctcacacc ggccagcatg
     6601 atttggtcat cccccccaat ggttatttta ggtttgattc ctgggttaat caattctaca
     6661 cgcttgcccc catgggaaat ggaacggggc gtagacgtgc tttataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttag ctctggactt ggctccctaa tcaatgctgg
     6781 ggctggggct atcaaccaaa agattgattt tgaaaataac agaaaattgc agcaagcttc
     6841 cttccagttt agcagtaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacta aaaagttgca acaggaaatg atgaaggtca aacaggcaat
     6961 gcttttagaa ggtggattct ttgaaacaga tgcagcccgt ggggcaatca acgcccctat
     7021 gacaaaggct ttggactgga gcggaacaag gtactgggcc cctgatgcta ggactacaac
     7081 atacaatgca ggccgctttt ccacccttca accttcgggg gcactgccag gaagaatcag
     7141 tcccaggact cctactcccg ctcggggctc ccccagtata tcttctaatg cttctactgc
     7201 tacttctata tattcaaatc aaactgtttc aacgagactt ggttctacag ctggttctgg
     7261 caccaatgtc tcgagtctcc cgtcaactgc aaggactagg agttgggttg aggatcaaaa
     7321 cagggatttg tcacctttca tgaggggggc tcacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 ggctggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta ggcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt ccttttcttt agtgtctttt
//