Typing tool

Complete norovirus genomes

HM596590  GII.5
 GII.P16

Length: 7,536 | 3 CDS

ORF1: 5..5101
ORF2: 5082..6704
ORF3: 6704..7480
LOCUS       HM596590                7536 bp    RNA     linear   VRL 22-APR-2019
DEFINITION  Norovirus GII strain
            Hu/GII.P16-GII.5/RUS/Novosibirsk/Nsk-N490/2010, complete genome.
ACCESSION   HM596590
VERSION     HM596590.4
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7536)
  AUTHORS   Zhirakovskaia,E.V., Tikunov,A.Y., Bodnev,S.A., Klemesheva,V.V.,
            Netesov,S.V. and Tikunova,N.V.
  TITLE     Molecular epidemiology of noroviruses associated with sporadic
            gastroenteritis in children in Novosibirsk, Russia, 2003-2012
  JOURNAL   J. Med. Virol. 87 (5), 740-753 (2015)
   PUBMED   25693507
REFERENCE   2  (bases 1 to 7536)
  AUTHORS   Zhirakovskaia,E., Tikunov,A., Tymentsev,A., Sokolov,S.,
            Sedelnikova,D. and Tikunova,N.
  TITLE     Changing pattern of prevalence and genetic diversity of rotavirus,
            norovirus, astrovirus, and bocavirus associated with childhood
            diarrhea in Asian Russia, 2009-2012
  JOURNAL   Infect. Genet. Evol. 67, 167-182 (2019)
   PUBMED   30414977
REFERENCE   3  (bases 1 to 7536)
  AUTHORS   Zhirakovskaya,E. and Tikunova,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-JUN-2010) Siberian Branch of Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine,
            Lavrentiev Ave. 8, Novosibirsk 630090, Russia
REFERENCE   4  (bases 1 to 7536)
  AUTHORS   Zhirakovskaya,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2018) Siberian Branch of Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine,
            Lavrentiev Ave. 8, Novosibirsk 630090, Russia
  REMARK    Sequence update by submitter
COMMENT     On Apr 22, 2019 this sequence version replaced HM596590.3.
FEATURES             Location/Qualifiers
     source          1..7536
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.P16-GII.5/RUS/Novosibirsk/Nsk-N490/2010"
                     /isolate="Hu/GII/Nsk-N490/2010/RUS"
                     /isolation_source="feces"
                     /host="Homo sapiens; sex: F; age: 8 months"
                     /db_xref="taxon:122929"
                     /country="Russia: Novosibirsk"
                     /collection_date="31-May-2010"
                     /note="genotype: GII.P16/GII.5"
     5'UTR           1..4
     gene            5..5101
                     /gene="ORF1"
     CDS             5..5101
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AZL94858.1"
                     /translation="MKMASNDATVAVACNNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPASRDNSQKPSRPPTPELVKKIPPPPPNGEKEEPVIRFEVKGGVSGLPELTTVPQP
                     EMTNTAFSVPPLSLRESREAKEPLTGAILEMWDGEIYHYGLYVEKGMVLGVHKPPAAI
                     SMAKVEMTPLSLYWRVVYTPQYLISPETLKRLNGEAFPYTAFDNNCYAFCCWVLDLND
                     SWLSRRMVQRTTGFFRPYQEWNRKPLPTVDDSKIKKVANIFLCSLSTLFTRPIKDIIG
                     KIKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGEYELQGPE
                     DIAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFF
                     PKKEEANELAMVRAIEDAVLDLEAIENNHMTALLKDKDSLATYMKTLDLEEEKARRLS
                     TKSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLARE
                     VARKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADT
                     CPLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYADAPEVE
                     KAKRDFPGQPDMWKDAFKADFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIAR
                     ASGLLHERMDEFELQGPTITTFNFDRNRITAFRQLAAENKYGLVDTMRVGNQLKGVKT
                     MEELKQAIKNVTIKRCQIIYNGSTFDLESDGKGKVLVEKVKNTSVQTNNELAGALHHL
                     RSARIRYYVKCVQEAIYSILQIAGAAFVTTRIARRMNIQELWSKPPLDQSEPEVKEEA
                     PKLENDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLVT
                     GSEIRKRNPDDFKPKGKLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPS
                     LFITSTHVIPAGITEAFGVPIKQIQIHKSGEFCRFRFPKPIRPDVTGMILEEGAPEGT
                     VATVLIKRPTGELMPLAARMGTHATMKIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDC
                     GCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGP
                     GGAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPKPNVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGYPHHVRKNEFWN
                     GETFTGKLADQASKANLMFEEGKHMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDLS
                     TMIRCARAFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVRFSAEPQLAQTVAEDLLAPSVVDVGDFKISINEGLPSGVPCTS
                     QWNSITHWLLTLCAVSEVTNLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLRE
                     YGLKPTRPDKTEGPLIISEDLDGLTFLRRTVARDPAGWFGKLDQSSILRQMYWTRGPN
                     HEDPSETMIPHSQRPIQLMALLGEASLHGPSFYNKISKLVITELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     mat_peptide     5..997
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     998..2095
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2096..2626
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2627..3025
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3026..3568
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3569..5098
                     /gene="ORF1"
                     /product="RNA-dependent RNA polymerase"
     gene            5082..6704
                     /gene="ORF2"
     CDS             5082..6704
                     /gene="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="AZL94857.2"
                     /translation="MKMASNDAAPSNDGAAGLVPESNNEAMALEPVAGASLAAPVTGQ
                     TNIIDPWIRTNFVQAPNGEFTVSPRNSPGEILVNLELGPELNPYLAHLSRMYNGYAGG
                     MEVQVLLAGNAFTAGKIIFAAVPPYFPVENLSPSQITMFPHVIIDVRTLEPVLLPMPD
                     VRSTLFHFNQKDEPKMRLIAMLYTPLRSNGSGDDVFTVSCRILTRPSPEFDFTYLVPP
                     TVESKTKPFTLPVLTLGELSNSRFPLSIDEMVTSPNESIVVQPQNGRVTLDGELLGTT
                     QLQACNICSLRGRITGQVPNEQHMWNLQITNLNGTQFDPTDDVPAPLGVPDFAGEVFG
                     VLSQRNRGEGNPANRAHDAVVATYSDKYTPKLGLVQIGTWNTNDVENQPTKFTPIGLN
                     EVSDGHRFEQWTLPRYSGALTLNMNLAPAVAPLFPGERLLFFRSYVPLKGGFGNPAID
                     CLVPQEWVQHFYQESAPSLGDVALVRYVNPDTGRVLFEAKLHKGGFLTVSSTSTGPVV
                     VPANGYFRFDSWVNQFYSLAPMGTGNGRRRFQ"
     gene            6704..7480
                     /gene="ORF3"
     CDS             6704..7480
                     /gene="ORF3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QCD16861.1"
                     /translation="MAGAFIAGLAGDVLSNGLGSLINAGANAINQRAEYDFNRQLQQN
                     SFNHDKEMLNAQIQATKQLQADMIAIKQGVLAAGGFSPTDAARGAVNAPMTQALDWSG
                     TRYWAPGSMKTTSYSGKFVSMNPVRQVEFSQPRKSATTPSSASSVSSGRTNSTNSTQS
                     TVVSASSVPPSRGSPASSTLSRATARTSNWVEEQNRNLEPYMKGALQTAFVTPPSSRA
                     SSNGSVSTVPKGVLDSWTPAFNTRRQPLFAYLRKKGESQA"
     3'UTR           7481..7536
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgtcgccgtt gcttgcaaca acaacaacga
       61 caaggaaaaa tcttcgggcg aaggcctatt tacaaatatg tcttctaccc taaagaaagc
      121 cctcggggct cggcccaaac agcctgcctc gagggacaac tcacaaaagc cctcaagacc
      181 accaacgccc gagttggtca agaaaatacc ccctccccca cctaatggcg aaaaagaaga
      241 accagtaatt aggtttgagg ttaagggtgg agtctctggc ttacccgaac tcacgacagt
      301 cccccaaccg gaaatgacca atacggcatt cagtgtacca ccgttgagct tgagagagag
      361 cagggaggcc aaggaaccac tgactggggc aatactggag atgtgggatg gagaaatata
      421 ccactatggc ttgtatgtgg agaaaggcat ggtgttgggc gtgcacaaac cacctgcagc
      481 tataagtatg gcaaaagtgg agatgacgcc gctgtcatta tactggcgtg tggtatatac
      541 tccccagtac ctcatctccc ctgaaactct caagaggctc aacggagaag cattccctta
      601 cactgctttt gacaacaact gttatgcctt ttgctgttgg gtattagacc ttaatgattc
      661 atggctcagc agaaggatgg tgcagagaac aacaggtttc tttagaccct accaggagtg
      721 gaacagaaag cccttaccca ctgtggatga ctctaaaatt aagaaggtgg caaacatatt
      781 cttatgctca ttgtccacgc tgttcaccag gcctataaag gacatcatag ggaaaatcaa
      841 accattaaac atcttgaaca tcctggcaac gtgtgactgg acgttcgccg ggattgtaga
      901 gtctctgata ctacttgctg aactctttgg agttttctgg acacccccag atgtgtctgc
      961 tatgatcgct cccttacttg gtgaatacga gttgcaaggg ccagaagaca tcgccgttga
     1021 acttgtgcct gtagtaatgg gggggattgg tttggtgcta ggatttacca aagagaaaat
     1081 tggcaaaatg ttgtcctctg cagcgtcaac gctcagggct tgcaaagatc ttggcgccta
     1141 tggcttagag atactcaaat tggtcatgaa atggtttttc ccaaagaaag aagaggccaa
     1201 tgagctagcc atggtgagag caatagagga tgctgtgctg gatcttgagg cgatagagaa
     1261 caaccacatg acagctctgc tgaaagacaa agacagccta gcaacctaca tgaaaacact
     1321 ggatttggag gaagaaaaag ccagaaggtt gtctacaaaa tctgcatccc ctgatatagt
     1381 tgggacaatt aatgccctat tggcccgaat agcggcagct agatcactag tccacagggc
     1441 caaagaggag ctgtctagca gaatcaggcc agttgttgtt atgatatctg gcaagccagg
     1501 gataggcaag acccacctgg ccagggaggt ggctagaaag gtggcatcca ccctcactgg
     1561 ggatcaaaga gtcggactca taccgaggaa tggtgtggac cattgggatg cgtacaaagg
     1621 tgagagggtc gtgctgtggg atgactatgg catgagcaac cccatccatg atgccctgcg
     1681 catacaggaa ctggccgaca cgtgtcccct taccttaaat tgtgatagaa ttgaaaataa
     1741 gggaaaagtc tttgatagtg aagtcataat aatcacaaca aaccttgcca atccagctcc
     1801 ccttgattat gtcaactttg aggcctgctc caggagaatt gattttctgg tgtatgccga
     1861 cgcaccagaa gtagaaaagg caaaacgaga cttccctggc caaccagaca tgtggaaaga
     1921 cgccttcaaa gcggactttt cgcatatcaa gttacaactt gcgcctcagg gcggctttga
     1981 taagaatggc aataccccac atgggaaggg tgtgatgaag accctcacta ccggttctct
     2041 gattgcccgt gcgtcaggcc tactgcatga gaggatggat gagtttgaac tccagggccc
     2101 cacaatcacc actttcaatt tcgaccgaaa cagaatcacc gcctttagac aattggctgc
     2161 agaaaacaaa tatgggttgg tggacaccat gagagttggc aaccaattga aaggggtgaa
     2221 aaccatggaa gaactcaagc aagctatcaa gaatgtaacc atcaagaggt gccagattat
     2281 ctacaatggt tccacgttcg accttgagtc tgatggcaag ggtaaagttt tggtggaaaa
     2341 ggtcaaaaac acctctgtcc aaaccaacaa tgagctggcc ggagccctac atcacctcag
     2401 aagtgctcga attaggtatt atgtcaagtg tgtgcaagaa gcaatctact ccatcctaca
     2461 aattgccggc gctgcattcg ttaccacacg cattgcacgt cgcatgaaca tacaagagct
     2521 ttggtcaaaa ccaccactag accaaagcga accggaggtt aaagaagagg cccccaagtt
     2581 agaaaatgat gagttcatca tatcctccaa agacattaag gaggaaggaa agaagggcaa
     2641 aaacaaaacc ggccgtggca agaaacacac tgcattttct agcaagggct taagcgatga
     2701 ggagtatgat gagtacaaga ggataagaga agaaagaaat gggaaatact ctatagagga
     2761 gtatcttcaa gacagagaca ggtactatga ggaactcgcc atcgccaagg ccacggagga
     2821 agatttctgc gaggaggaag aaattaaaat ccgccagagg atctttcgtc ccaccagaaa
     2881 acaaaggaag gaagaaaggg ccacgctagg gctagtaact ggttcagaaa ttagaaagag
     2941 aaaccctgat gacttcaaac ctaaagggaa actgtgggca gacgacaaca ggagtgttga
     3001 ctacaacgaa aaattggact ttgaggcccc cccaagcata tggtctagga ttgtgagttt
     3061 tggttctggt tggggctttt gggtgtcacc aagcctgttc ataacatcaa ctcatgtaat
     3121 ccctgcgggc ataacagagg catttggagt ccccatcaaa caaatccaaa ttcacaagtc
     3181 aggtgagttt tgccggttca ggttcccaaa accaattaga ccagatgtga caggaatgat
     3241 cctggaagaa ggtgcgccag agggcaccgt ggcaaccgtg ctcattaaac gccccaccgg
     3301 agaactcatg cccctcgcag ccagaatggg gacacacgca accatgaaaa ttcaggggcg
     3361 catggttggc ggacaaatgg gtatgttgct cactggttca aatgctaagg gcatggattt
     3421 ggggacaact cctggtgact gtgggtgccc gtacatctat aaaaggggca atgactatgt
     3481 agtcattgga gtgcacacag cagctgcccg tggtggaaac actgtcatct gcgccacaca
     3541 gggaagtgaa ggtgaggcga ctctcgaagg tggagacgat aaaggaacat actgtggggc
     3601 acccatcctg ggtcctggag gggcaccaaa attgagcacc aagaccaaat tttggagatc
     3661 atcaaacacg cctcttccac cagggacata cgagcccgct taccttggtg gtcgtgatcc
     3721 acgtgtaaag ggtggaccct ctttacagca agtcatgaga gaccagttaa agcctttcac
     3781 tgaacccagg ggtaaacccc caaagcccaa tgtgctggag gcagctaaac aaaccatcat
     3841 caacgtcctc gagcaaactt tggatccccc acaaaagtgg acatacgcac aggcgtgcgc
     3901 ttcacttgat aagaccacct ccagcgggta cccccatcac gtccgaaaga atgaattctg
     3961 gaatggtgag accttcactg gcaagttggc agatcaagcg tcaaaagcga acttgatgtt
     4021 tgaggaaggg aaacacatga cgccagtgta cacagcagcc ctcaaggatg agctggtcaa
     4081 gactgacaaa atctatggaa agatcaagaa aagattgctc tggggttctg acttgtccac
     4141 catgatccga tgtgccaggg cttttggtgg actcatggat gagatgaagg cacactgcat
     4201 atcactccca gtccgagttg gtatgaacat gaatgaggat ggcccaataa tatttgagaa
     4261 acattccaga tacaagtacc attatgatgc agactattcc cgctgggact cgacacaaca
     4321 gagggctgtc ctagcagcgg ccttggaaat aatggtcaga ttctctgcag aaccacaact
     4381 ggcgcaaaca gtcgctgaag acctgctggc ccccagtgtg gtggatgtag gagactttaa
     4441 aatttcaata aacgaggggc tcccttctgg tgtgccatgc acttcccaat ggaactccat
     4501 cacgcattgg ctactaactc tttgtgctgt gtctgaagtc accaacctgt cccctgacat
     4561 cgtacaggca aattccatgt tctcattcta cggtgatgac gagattgtca gtaccgatat
     4621 aaaattagac cctgaaaagt taactaccaa attgagggag tatggtttga aaccaacccg
     4681 cccagataaa actgagggac ccctgatcat cagtgaggat ttggacgggc tcaccttcct
     4741 ccggaggaca gttgcccgtg acccggctgg ctggtttgga aagttggatc aaagctcaat
     4801 actgagacag atgtactgga ccagaggacc aaaccacgaa gatcccagtg aaacaatgat
     4861 accccattct caaagaccca tacagctcat ggcactgctt ggcgaggcct ctcttcacgg
     4921 accatctttc tacaacaaga ttagtaaatt ggtcataact gaactcaaag aaggtgggat
     4981 ggatttttac gtgccaaggc aggaacctat gttcaggtgg atgaggtttt ctgacttgag
     5041 cacgtgggag ggcgatcgca atctggctcc cagttttgtg aatgaagatg gcgtcgaatg
     5101 acgccgctcc atctaatgat ggtgctgccg gcctcgtgcc agaaagtaac aatgaggcaa
     5161 tggctcttga acccgtggcg ggagcgtctc tagccgcgcc tgtcactggt caaactaata
     5221 taatagaccc ctggatcaga actaattttg tccaagcccc taatggtgaa tttacagttt
     5281 cccctcgaaa ttcccctgga gaaatattgg tcaatttgga gctgggtcca gaattaaacc
     5341 cttatctggc acatttatct aggatgtaca atggttatgc aggtggtatg gaggtgcaag
     5401 tattgctcgc agggaacgcg ttcactgctg gtaagatcat cttcgctgcc gtgccacctt
     5461 attttccagt tgaaaatctt agcccttctc aaataacaat gttcccacat gtgattattg
     5521 atgttagaac cttggaacct gtgttactcc caatgcctga tgtcagaagt actttgtttc
     5581 atttcaatca aaaggatgaa cctaaaatga ggcttattgc tatgctttac actcctctcc
     5641 gctctaatgg ttctggtgat gatgttttca ccgtttcatg taggatcctt accagacctt
     5701 cccctgaatt tgattttaca tatttagtgc caccaacagt agagtcaaag actaagcctt
     5761 tcacactgcc tgtgctaaca ctgggagagc tgtccaactc cagatttccc ctctccattg
     5821 atgagatggt caccagtcct aatgagtcca tagttgtcca gccacagaat ggcagagtca
     5881 cgctggacgg tgagctgttg ggcacaactc aattgcaagc atgcaacatc tgctctttga
     5941 gagggaggat cacagggcag gttcccaatg aacaacacat gtggaacctg cagatcacaa
     6001 acctaaatgg tacacaattt gaccccacgg atgatgtccc agcccccctt ggtgtgcccg
     6061 attttgcagg tgaggttttt ggtgtactta gtcagagaaa caggggtgag ggcaacccag
     6121 caaacagggc tcacgatgca gtcgtggcca cttatagtga caagtacacc cccaaattgg
     6181 gcttagtgca aattggaact tggaacacca atgatgttga aaatcagcca acaaaattca
     6241 caccaattgg cctgaatgag gttagtgatg gccatcggtt cgaacagtgg accctgccta
     6301 ggtactctgg tgccctaact ctaaatatga acttggctcc tgctgtagcc ccactctttc
     6361 ctggagagcg ccttctcttc ttccgctctt atgtaccatt gaaaggtgga tttgggaacc
     6421 ctgctataga ttgtctggtg cctcaagaat gggtccaaca cttctaccag gaatctgccc
     6481 cctctctggg agacgtggcc ctagtcaggt atgtcaaccc agacaccggg cgtgtcctct
     6541 ttgaggccaa actccacaag ggtgggttct taactgtgtc aagcaccagt acagggcctg
     6601 ttgtggtgcc agccaatggt tatttcagat ttgattcttg ggttaatcaa ttttattctc
     6661 tcgcccccat gggaactggg aatgggcgca gaagatttca ataatggcag gagcttttat
     6721 agcaggttta gcaggtgatg tgcttagtaa tggcctcggt tcgttgatca atgccggagc
     6781 caatgctatt aatcaaagag cagaatatga ttttaataga caattgcagc aaaattcttt
     6841 taatcatgat aaagaaatgt tgaatgccca gatccaagca acaaaacaat tgcaggctga
     6901 tatgatagca atcaaacaag gagtgctggc tgctgggggc ttttccccaa ctgacgcggc
     6961 cagaggagct gtcaatgcac ccatgaccca agcactggat tggagcggca ctaggtactg
     7021 ggcccctgga tcaatgaaga ccaccagcta ctctgggaag tttgtgtcca tgaaccctgt
     7081 caggcaggtt gaattctcgc aacccagaaa gagtgcaact acaccatcaa gtgccagttc
     7141 tgtgtcttcc ggtagaacta actcaacaaa ctccactcaa tcaactgttg tcagtgcttc
     7201 ttcagtgcca ccttccagag gctcccctgc ttcctctact ttgtcaaggg ctacagctag
     7261 aacatccaat tgggttgaag aacaaaatag gaatttggag ccctacatga agggtgccct
     7321 ccaaacagca tttgtcactc ctccctccag cagagcatct agcaatggat cagtctcaac
     7381 tgtaccaaaa ggtgttttgg actcctggac acctgcgttc aacacccgca ggcagccgct
     7441 ttttgcttac cttcgcaaga agggggagtc acaagcttag tgaaaagata attagtggtt
     7501 aataattgat cttttaaaaa aaaaaaaaaa aaaaaa
//