Typing tool

Complete norovirus genomes

GU991355  GII.3
 GII.P12

Length: 7,544 | 3 CDS

ORF1: 5..5101
ORF2: 5082..6728
ORF3: 6728..7492
LOCUS       GU991355                7544 bp    RNA     linear   VRL 27-FEB-2012
DEFINITION  Norovirus Hu/Shanghai/SH312/2009/CHN, complete genome.
ACCESSION   GU991355
VERSION     GU991355.1
KEYWORDS    .
SOURCE      Norovirus Hu/Shanghai/SH312/2009/CHN
  ORGANISM  Norovirus Hu/Shanghai/SH312/2009/CHN
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7544)
  AUTHORS   Shen,Q., Zhang,W., Yang,S., Chen,Y., Shan,T., Cui,L. and Hua,X.
  TITLE     Genomic organization and recombination analysis of human norovirus
            identified from China
  JOURNAL   Mol. Biol. Rep. 39 (2), 1275-1281 (2012)
   PUBMED   21611752
REFERENCE   2  (bases 1 to 7544)
  AUTHORS   Shen,Q., Zhang,W., Yang,S. and Chen,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-MAR-2010) Shanghai JiaoTong University, School of
            Agriculture and Biology, 800 Dongchuan Road, Shanghai 200240, China
FEATURES             Location/Qualifiers
     source          1..7544
                     /organism="Norovirus Hu/Shanghai/SH312/2009/CHN"
                     /mol_type="genomic RNA"
                     /isolate="Hu/Shanghai/SH312/2009/CHN"
                     /host="Homo sapiens"
                     /db_xref="taxon:756497"
                     /country="China"
                     /collection_date="Jan-2009"
     CDS             5..5101
                     /note="contains nonstructural proteins, N-terminal,
                     NTPase, 3A-like protein, VPg, Protease, and RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ADF47130.1"
                     /translation="MKMASNDASAAAAANSNNDNAKSSSDGVLSSMAVTFKRALGARH
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVWQPD
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     VRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISAARIGKTHLARELA
                     KKIAASLTGDQRVGLIPRNGVDHWDAYKEERVVLWDDYGMRSSHHDALRLQELADTCP
                     LTLNCDRIENKGKVFGSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEKA
                     KRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARAS
                     GLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLLDTMRVGKQLKDVKTMP
                     ELKQALKNVAIKNCQIVYGGCTYRLESDGKGNVKVDRVQSTSVQTNNELAGALHHLRC
                     ARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATDKDGCP
                     KPKDIEEFVISSDDIKTEGKKGKNKAGRGKKHTAFSSKGLSDEEYDEYKRIREERNGK
                     YSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLVT
                     GSEIRKRNPEDFKPKGKLWADDDRNVDYNEKLSFEAPPGIWSRIVNFGSGWGFWVSPS
                     LFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEGT
                     VVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGDC
                     GCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILGP
                     GSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPR
                     GKPPRPSVLEAAKKTIVNVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCWN
                     GESFTGKLADQASKANLMFEEGKSMTPVYTGALMDELVKTDKIYGKIKKRLLWGSDLA
                     TMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWDS
                     TQQRAVLAAALEIMVKFSPEPHLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCTS
                     QWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKE
                     YGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPN
                     HEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEP
                     MFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5082..6728
                     /codon_start=1
                     /product="VP1"
                     /protein_id="ADF47131.1"
                     /translation="MKMASNDAAPSNDGAAGLVPEINNEAMALEPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPVNLPMPD
                     VRNNFFHYNQGSDSRLRLVAMLYTPLRANNSGDDVFTVSCRVLTRPSPDFSFNFLVPP
                     TVESKTKPFTLPILTISEMSNSRFPVPIDSLHTSPTENIVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGVLTRSTSRASDQADTATPRLFNYYWHIQLDNLNGTPYDPAEDIPGP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKVDTTAGRFTPKLGSLEISTESGDFNQNQP
                     TRFTPVGIGVDHEEDFQQWSLPDYSGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPTQTQVALVRYVNPDTGRVLFEAKLHKLGFMTIA
                     KNGDSPITVPPNGYFRFESWVNPFYTLAPTGTENGRRRVQ"
     CDS             6728..7492
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ADF47132.1"
                     /translation="MAGAFIAGLAGDIFTNTVGSLVNAGANAINQKVDFENNKYLQNA
                     SFNHDKEMLNAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAISAPMTKVLDWNG
                     TRYWAPNATSTTSMSGGFTNQAVHRTAPNFKTNQAPKSTPSSGSSVRSLSTQITSLSS
                     HSSGSSRSSGSTVVSSLPSSNRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTVSSSG
                     TVSTVPKKFWTPGQSAFNTRRQPLFAHLRRRGESNV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgctaaca gcaacaacga
       61 caacgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcataaac agcctccccc gagggaaata ccacaaaggc ctccacggcc
      181 acccacccca gaactggtca aaaagatccc tcctccccca cccaacgggg aggatgaact
      241 agtggtctct tacagcgcca aagatggcgt ttctggtttg cctgagctta ccactgtctg
      301 gcagccggat gaaaccaata cggcgttcag tgttccccca ctcaatcaga gggagaacag
      361 ggacgccaag gagccgctga ccggaacaat cctggaaatg tgggacgggg agatctatca
      421 ttacggtctg tatgtggagc gaggccttgt acttggtgtg cacaaaccac cagctgccat
      481 cagcctcgcc aaggttgagc tagcaccact ctctctgttt tggaggccag tgtacacacc
      541 acagtatctc atctctccag acactctcag gagactgcat ggagagtcgt tcccctacac
      601 agcctttgac aacaactgct atgccttctg ttgttgggtt ctggacctaa acgactcgtg
      661 gttgtgcagg agaatgatcc agagaacaac tggtttcttc agaccttacc aagactggaa
      721 caggaaaccc ctccccacca tggatgactc caaattaaag aaggtagcca acatattctt
      781 gtgtgcacta tcttcgctat tcactaggcc catcaaagac ataataggaa aggtgagacc
      841 gctcaacatc cttaacatct tggcctcatg tgattggact tttgcaggca tagtggaatc
      901 tttgatcctc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttactaggtg actacgaact gcaggggcct gaggaccttg cagtggaact
     1021 cgtaccagta gtgatggggg ggattggttt ggtgttagga ttcaccaaag agaagatcgg
     1081 aaaaatgttg tcatctgctg catccacctt aagagcttgt aaagaccttg gtgcatacgg
     1141 actggaaatc ctaaaattgg tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 gctggctatg gtgaggtcca tcgaggatgc ggtgctggac ctcgaagcaa ttgagaacaa
     1261 ccacatgact gccctcctca aagacaaaga cagcttggca acctacatga gaacccttga
     1321 cctcgaggag gagaaagcca ggaagctttc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gctctcctgg cgagaatcgc cgctgcacgt tccctggtgc atcgggcgaa
     1441 agaggaactc tccagcagac caagacctgt tgttgttatg atatcagcag ccaggatagg
     1501 gaaaactcac cttgccaggg agctagccaa gaaaatcgca gcttcgctta caggggacca
     1561 gcgcgtgggt ctcatccctc gcaatggcgt tgatcactgg gatgcataca aggaagaaag
     1621 agtcgtccta tgggacgatt atggaatgag gtcatcccat cacgacgccc tcaggttaca
     1681 ggaacttgct gacacctgcc cccttacgct aaattgtgac aggattgaga acaaaggaaa
     1741 ggtctttggc agtgatgcca taatcatcac cactaatctg gccaacccag caccattgga
     1801 ctatgtcaac tttgaagcat gctcgaggcg catcgacttc ctcgtgtacg cagaagcccc
     1861 tgaggtcgag aaagcaaagc gtgatttccc aggtcaacct gacatgtgga agaacgcatt
     1921 tagttctgac ttctcgcaca taaaactggc gctggctccg caaggtggct tcgacaagaa
     1981 cggaaacacc ccacacggga aaggcgttat gaaaaccctc accactggtt ccctcatcgc
     2041 ccgagcgtca gggctactcc atgagaggtt agatgagtat gagctgcagg gcccaacccc
     2101 caccaccttt aactttgacc gcaacaaggt gcttgcgttc agacagcttg ctgccgaaaa
     2161 caagtacgga ttgttggaca caatgagagt tggaaaacag ctcaaggatg tcaagaccat
     2221 gccagagctc aaacaagcac tcaaaaatgt cgcaatcaag aattgtcaga tagtgtatgg
     2281 tggctgcact tataggcttg agtctgatgg caagggtaat gtgaaagttg acagagttca
     2341 gagcacctcc gttcagacca acaatgagct ggctggcgcc ctgcaccatc taaggtgcgc
     2401 cagaatcagg tactatgtca agtgtgttca ggaggccctg tattctatca tccagattgc
     2461 tggggctgca tttgtcacca cgcgcatcat caagcgtgtg aacattcaag acttatggtc
     2521 caagccacaa gtggaaaaca cagaggaggc taccgacaag gacgggtgcc caaaacccaa
     2581 agatattgag gagttcgtca tttcatctga cgacattaaa actgagggta agaaagggaa
     2641 gaacaaggct ggccgtggca agaagcacac agccttctca agtaaaggtc tcagtgatga
     2701 agagtatgat gagtacaaga gaattagaga ggaaaggaat ggcaagtact ccatagaaga
     2761 gtacctacag gacagggaca aatactatga ggaggtggcc attgccaggg cgaccgagga
     2821 agacttctgt gaagaggagg aggccaagat ccggcaaagg atcttcaggc caacaaggaa
     2881 acaacgcaag gaagaaagag cttctctcgg tttagtcaca ggttctgaaa ttaggaaaag
     2941 gaacccagaa gacttcaagc ctaaggggaa actatgggcc gacgatgaca gaaatgtgga
     3001 ctacaatgaa aaactcagct ttgaggcccc accaggcatc tggtcaagga tagtcaactt
     3061 tggttcaggt tggggctttt gggtttcccc cagcctgttc ataacatcaa cccatgtcat
     3121 accccagggc gcacaggagt tctttggtgt tcccatcaaa caaattcaga tacacaaatc
     3181 gggtgaattc tgtcgcttga ggtttccaaa gccgatcaga actgacgtga caggcatgat
     3241 cttagaagaa ggtgcacccg aagggaccgt ggtcacatta ctcatcaaga ggccaactgg
     3301 agagctcatg cccctggcag ccagaatggg aacccacgca accatgaaga ttcaagggcg
     3361 cactgttgga ggtcaaatgg gcatgctcct aacagggtcc aacgccaaga gtatggacct
     3421 gggcaccaca ccaggtgact gtggctgccc ctacatttac aagaggggga atgactacgt
     3481 agtcattgga gtccacacag ctgccgcccg tggaggaaac actgtcattt gtgccaccca
     3541 ggggagcgag ggagaagcca cacttgaagg cggtgacagc aaggggacct actgtggtgc
     3601 accaatctta ggtccaggaa gtgccccaaa gctcagcacc aagactaagt tctggaggtc
     3661 atccacggca ccactcccac ctggtaccta tgagccagcc tacctcggcg gcaaggaccc
     3721 cagagttaag ggtggccctt cattgcaaca agttatgagg gaccaactga aaccattcac
     3781 tgagcctagg ggtaaaccac caagaccaag tgtgctagaa gccgccaaga aaaccatcgt
     3841 caatgtcctt gaacagacaa ttgatccacc tcaaaaatgg tcgtttgcgc aggcatgcgc
     3901 atcccttgac aagaccactt ccagcggtca cccgcaccat atgcggaaaa acgactgctg
     3961 gaacggggaa tcctttacag gaaaattggc agaccaggct tccaaggcca acctgatgtt
     4021 cgaggaggga aagagcatga ccccagttta cacgggtgcg cttatggacg agctggtcaa
     4081 gactgacaag atttatggca agatcaaaaa gaggcttctc tggggttcgg acctggcgac
     4141 catgattcgg tgcgcccgag cattcggagg cctgatggag gaactcaaag cacattgtgt
     4201 cacactacct gtcagagtgg gtatgaatat gaatgaggat ggtcctatca tctttgagag
     4261 acactccaga tataaatatc attatgatgc tgattactcc cggtgggact caacacaaca
     4321 aagagccgtg ctagcagcag ccttggaaat catggtcaag ttctccccag agccgcacct
     4381 ggcccaaaag gttgcagaag accttctttc tcccagcgtg atggacgtgg gtgatttcaa
     4441 aatatcaatc aatgagggtc tcccctccgg agtgccctgc acctcccaat ggaattccat
     4501 cgcccactgg ctcctcactc tctgtgcact ctccgaggtt acaaacctgt ctcctgacat
     4561 cattcaggcc aactctctct tttctttcta cggtgatgat gaaattgtga gtacagacat
     4621 aaaattggac ccagaaaaac tgacagcaaa actcaaggaa tacgggttga aaccgacccg
     4681 ccctgacaag actgaagggc ctcttgtcat ctccgaagac ctgaatggcc tgaccttcct
     4741 gcggaggacc gtgacccgcg acccagcagg ctggtttgga aagttggaac agagctcaat
     4801 actcagacaa atgtactgga ctaggggccc caaccatgaa gatccatctg aaacaatgat
     4861 accacactcc cagaggccca tacaattgat gtctttgctg ggtgaggcag cactccacgg
     4921 cccagcattc tacagcaaaa tcagtaaact ggtcattgca gagttgaagg aaggtggcat
     4981 ggatttttac gtgccaagac aagagccaat gttcagatgg atgagattct cggatctgag
     5041 cacgtgggag ggcgatcgca atctggctcc cagttttgtg aatgaagatg gcgtcgaatg
     5101 acgccgctcc atctaacgat ggtgccgccg gcctcgtccc agagatcaac aatgaggcaa
     5161 tggcgctaga accagtggcg ggtgcagcga tagcagcacc cctcactggc cagcaaaata
     5221 taattgatcc ctggattatg aataattttg tgcaagcacc tggtggtgag tttacagtgt
     5281 ctcctaggaa ttcccctggt gaagtgcttc tcaatttgga attgggccca gaaataaatc
     5341 cctatttggc ccatcttgct agaatgtata atggttatgc aggtgggttt gaagtgcagg
     5401 tagtcctagc tggaaatgcg tttacagcag gaaagataat ttttgcagct atacccccta
     5461 acttcccaat tgacaatcta agcgcagcac agatcacaat gtgcccacat gtgattgtgg
     5521 atgtcagaca gttggaaccg gtcaaccttc cgatgcctga cgttcgcaat aacttcttcc
     5581 attacaacca agggtctgat tcgagattgc gcttagttgc aatgctgtat acacctctta
     5641 gggcaaataa ttctggggat gatgttttta ctgtgtcttg tagagtgctg actaggccta
     5701 gccctgactt ttcatttaac ttccttgtgc cacccactgt ggagtcaaag acaaaaccct
     5761 tcaccctccc tattttgact atctctgaaa tgtctaattc taggtttcca gtgccgattg
     5821 attctctgca caccagccca actgagaata ttgttgtcca gtgccaaaat gggcgcgtca
     5881 ctcttgatgg tgagttgatg ggcaccaccc aactcttacc tagtcaaatc tgtgctttta
     5941 ggggcgtgct caccagatca acaagcaggg ccagtgacca ggccgacaca gcaaccccta
     6001 gattgtttaa ttattattgg cacatacaat tggataatct aaatgggact ccttatgatc
     6061 ctgcagaaga cataccaggc cccctgggga caccagactt ccggggcaaa gtctttggcg
     6121 tggccagcca gagaaatccc gacagtacaa ctagagcaca tgaagcgaag gtggacacaa
     6181 cagctggtcg ctttacccca aaactaggct cattggagat atccactgaa tctggtgact
     6241 ttaatcaaaa ccaaccaaca agattcaccc cagttggcat tggggttgac cacgaggaag
     6301 acttccaaca atggtcctta cccgactatt ctggtcagtt cactcacaac atgaacttag
     6361 ccccagctgt tgctcccaac ttccctggtg agcagctcct tttcttccgc tcacagttac
     6421 catcttctgg tgggcgatcc aatgggattc tagactgcct ggtcccccaa gaatgggttc
     6481 agcacttcta ccaagaatcg gcccccaccc aaacccaggt ggccctggtt agatatgtca
     6541 accctgacac tggtagagtg ttgtttgagg ccaagctgca caaattaggt ttcatgacta
     6601 tagctaagaa tggtgactct ccaataactg tccccccaaa tggatacttt aggtttgaat
     6661 cttgggtgaa cccattttat acacttgccc ccacgggaac tgagaatggg cgtagaaggg
     6721 ttcaataatg gctggagctt ttatagcagg attagctggt gatatattca caaatactgt
     6781 aggatctcta gttaatgcag gggctaatgc cattaatcaa aaagttgatt ttgaaaataa
     6841 caaatatttg caaaatgctt cctttaatca tgataaagaa atgttaaatg cacaaattga
     6901 ggcaacaaag aggttacagg ctgacatgat tgctatcaaa cagggggttt tgaccgctgg
     6961 cggcttttcc cccactgatg cagctcgcgg ggcaattagt gcccccatga caaaagtcct
     7021 agattggaat ggaacgaggt actgggcacc aaatgccacc tctacaacct cgatgtcggg
     7081 tggcttcaca aaccaggctg tgcacagaac cgcgccaaat tttaaaacga accaggcccc
     7141 caaatccaca cccagcagtg ggtcttcagt gaggtcactc tcaacccaaa tcactagtct
     7201 gagctcacac tcgtccgggt cgtctcgatc cagcgggtct acagttgtta gctcattacc
     7261 atcctctaac aggactaggg actgggtcaa tcaacaaaat ttcaatttgg aaccacacat
     7321 gcctgggtcc cttaggacag cttttgttac tccaccatct agtacagtct ctagttcagg
     7381 cactgtctca accgtgccca agaagttttg gactcctgga caatctgcgt ttaatacgcg
     7441 cagacagccg ctattcgcac accttcgtag aaggggggag tcaaatgttt agtgaaaaga
     7501 ttactttaaa tttgatttaa attggatttg atttggaatc tttt
//