Typing tool

Complete norovirus genomes

GU991353  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,555 | 3 CDS

ORF1: 3..5102
ORF2: 5083..6705
ORF3: 6705..7511
LOCUS       GU991353                7555 bp    RNA     linear   VRL 27-FEB-2012
DEFINITION  Norovirus Hu/GII/Shanghai/SH2/2008/CHN, complete genome.
ACCESSION   GU991353
VERSION     GU991353.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII/Shanghai/SH2/2008/CHN
  ORGANISM  Norovirus Hu/GII/Shanghai/SH2/2008/CHN
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7555)
  AUTHORS   Shen,Q., Zhang,W., Yang,S., Chen,Y., Shan,T., Cui,L. and Hua,X.
  TITLE     Genomic organization and recombination analysis of human norovirus
            identified from China
  JOURNAL   Mol. Biol. Rep. 39 (2), 1275-1281 (2012)
   PUBMED   21611752
REFERENCE   2  (bases 1 to 7555)
  AUTHORS   Shen,Q., Zhang,W., Yang,S. and Chen,Y.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-MAR-2010) Shanghai JiaoTong University, School of
            Agriculture and Biology, 800 Dongchuan Road, Shanghai 200240, China
FEATURES             Location/Qualifiers
     source          1..7555
                     /organism="Norovirus Hu/GII/Shanghai/SH2/2008/CHN"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII/Shanghai/SH2/2008/CHN"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:756495"
                     /country="China"
                     /collection_date="Dec-2008"
                     /note="group: GII"
     CDS             3..5102
                     /note="contains nonstructural proteins, N-terminal,
                     NTPase, 3A-like protein, VPg, Protease, and RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ADF47124.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEVVVSYSAKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLGQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATSKDGC
                     PKPKDNEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSVEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDGKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKDGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5083..6705
                     /codon_start=1
                     /product="VP1"
                     /protein_id="ADF47125.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNVPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6705..7511
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ADF47126.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGVLPGRTNPRTPTPARGSPSTSS
                     NASTATSIYSNQTVSTRLGSTAGSGTNVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
ORIGIN      
        1 gaatgaagat ggcgtctaac gacgcttccg ctgccgctgt tgctaacagc aacaacgaca
       61 ccgcaaaatc ttcaagtgac aaaatgtttt ctagcatggc tgtcactttc aaacgagccc
      121 tcggggcgcg gcctaaacag ccccccccga gggaaatacc acaaagaccc ccacgaccac
      181 ctactccaga actggtcaaa aagatccctc cccccccgcc caacggagag gatgaagtag
      241 tggtttctta tagtgccaaa gatggtgttt ccggtttacc tgagctttcc accgtcaggc
      301 aaccggaaga aaccaatacg gctttcagtg tccctccact cggtcagagg gagaataggg
      361 atgctaagga accactgact ggaacaattc tggaaatgtg ggatggagaa atctaccatt
      421 atggcctgta tgttgagcga ggtcttgtgc tgggtgtgca caaaccacca gctgccatta
      481 gcctcgccaa ggtcgaacta acaccactct ccttgttctg gagacctgtg tacactcctc
      541 agtacctcat ctctccagac actctcaaga aattacacgg agaaacattt ccctacacag
      601 ccttcgacaa caattgctat gccttttgtt gctgggtcct ggatctaaac gactcgtggc
      661 taagtaggag aatgatccag agaacaactg gcttcttcag accctaccaa gattggaata
      721 ggaaacccct ccccactatg gatgattcca aattaaagaa ggtagctaac atattcctgt
      781 gcaccctgtc ttcgctattc accaggccca taaaagacat aatagggaag ttaaggcctc
      841 tcaacatcat caacatcctg gcttcatgtg attggacttt cgcaggcata gtggagtcct
      901 tgatactctt ggcagagctc tttggagtct tctggacacc cccagatgtg tctgcgatga
      961 ttgccccctt actcggtgat ttcgagttac aaggacctga ggaccttgta gtggagctcg
     1021 tccctgtagt aatgggggga attggtttgg tgctaggatt caccaaagag aagattggaa
     1081 aaatgttgtc atctgctgca tctaccttga gagcttgtaa agatctcggt gcgtatgggc
     1141 tagagatcct aaagttagtc atgaagtggt tcttcccgaa gaaagaggaa gcaaatgaac
     1201 ttgctatggt gagatccatc gaggatgcag tgctggacct tgaggcaatt gaaaacaacc
     1261 atatgaccac cttgctcaaa gacaaagaca gcctggcaac ctatatgaga acccttgacc
     1321 tcgaggaaga gaaagccaga aaactctcaa ccaagtctgc ttcacctgac atcgtgggca
     1381 caatcaacgc ccttctggcg agaatcgccg ctgcacgctc cctggtgcac cgagcgaagg
     1441 aggagctctc tagcagacca agacctgtag tcttgatgat atcaggcaga ccaggaatag
     1501 ggaagaccca ccttgctagg gaagtggcta agagaatcgc agcctccctc acaggagacc
     1561 agcgtgtagg cctcatccca cgcaatggcg tcgatcactg ggatgcgtac aagggggaga
     1621 gggtcgtcct atgggacgac tatggaatga gcaaccccat ccacgacgcc ctcaggctgc
     1681 aagaactcgc tgacacttgc cccctcactc taaattgtga caggattgag aataaaggaa
     1741 aggtctttga cagcgatgtc atcattatca ctactaacct ggccaaccca gcaccactgg
     1801 actatgtcaa ctttgaagcg tgctcgaggc gcattgattt cctcgtgtat gcagaagccc
     1861 ccgaggtcga aaaggcaaag cgtgacttcc cgggccaacc tgacatgtgg aaaaacgctt
     1921 ttagttctga tttctcacac ataaaattgg cactggctcc acaaggtggc tttgataaga
     1981 acgggaacac cccacatggg aagggcgtca tgaagactct caccactggc tccctcattg
     2041 cccgggcatc agggctgctc catgagagat tggatgagtt tgaactacag ggcccagctc
     2101 tcaccacctt caactttgac cgcaacaaag tgcttgcctt caggcagctt gctgctgaaa
     2161 acaaatacgg gttgatggac acaatgaaag ttgggaggca gctcaaggat gtcaaaacca
     2221 tgccagaact taaacaagca ctcaagaata tctcaatcaa gaagtgccag attgtgtata
     2281 gtggttgcac ctacacactt gagtctgatg gcaagggcaa tgtgaaagtt gacagagttc
     2341 agagcacctc cgttcagacc aacaatgagc tggctggcgc cctgcaccac ctaaggtgcg
     2401 ccagaatcag gtactatgtc aagtgtgttc aggaggccct gtattccatc atccagattg
     2461 ctggggctgc atttgtcacc acgcgcatca tcaagcgtgt gaacattcaa gacttatggt
     2521 ccaagccaca agtggaaaat acagaggagg ccaccagcaa ggacgggtgc ccaaaaccca
     2581 aagacaatga ggagttcgtc atttcatctg acgacattaa aactgagggt aagaaaggga
     2641 agaacaagac tggccgtggc aagaagcaca cagccttctc aagtaaaggt ctcagtgatg
     2701 aagagtatga tgagtacaag agaattagag aggaaaggaa tggtaagtac tccatagaag
     2761 agtaccttca ggatagggac aaatactatg aggaggtggc cattgccagg gcgaccgagg
     2821 aagacttctg tgaagaggag gaggccaaga tccggcaaag gatcttcaga ccaacaagga
     2881 aacaacgcaa ggaagaaaga gcttctctcg gtttagtcac aggttctgaa attaggaaaa
     2941 ggaacccaga agacttcaag cctaagggga aactatgggc tgacgatgac agaagtgtgg
     3001 actacaatga aaaactcagt gttgaggccc caccaagcat ctggtcaagg atagtcaact
     3061 ttggctcagg ttggggcttc tgggtctccc ccagcctgtt tataacatca acccacgtca
     3121 taccccaggg cgcaaaggag ttctttggag tccccatcaa acaaattcag gtacacaagt
     3181 caggcgaatt ctgtcgcttg aggttcccaa aaccaatcag gactgatgtg actggcatga
     3241 tcttggaaga aggtgcgccc gaaggcaccg tggtcacact actcatcaaa aggtctactg
     3301 gagagctcat gcccctagca gctagaatgg ggacccatgc aaccatgaaa attcaagggc
     3361 gcactgttgg aggtcagatg ggcatgcttc tgacaggatc caacgccaaa agcatggatc
     3421 taggcaccac accaggtgat tgcggctgtc cctacatcta caagagagga aatgactatg
     3481 tggtcattgg agtccacacg gctgctgctc gtgggggaaa cactgtcata tgtgccaccc
     3541 aggggggtga gggggaagct acacttgaag gtggtgacgg taagggaaca tactgtggcg
     3601 caccaatcct aggcccaggg agtgccccaa aacttagcac caaaaccaaa ttctggagat
     3661 catccacagc accactccca cctggcacct atgaaccagc ctaccttggt ggcaaggacc
     3721 ccagagtcaa ggatggcccc tcgttgcagc aagttatgag ggaccagcta aaaccattta
     3781 cagagcctag gggtaagcca ccaaagccaa gtgtgttaga agctgccaag aaaaccatca
     3841 tcaatgtcct tgaacaaaca attgacccac ctgagaagtg gtcgttcgca caagcttgcg
     3901 cgtcccttga caagaccact tctagcggcc atccgcacca catgcggaaa aatgactgct
     3961 ggaacgggga atctttcaca ggcaagctgg cagaccaggc ttccaaggcc aacctgatgt
     4021 ttgaagaagg gaagaacatg accccagtct acacaggtgc acttaaggat gaattagtca
     4081 aaactgacaa aatttatggc aagatcaaga agaggcttct ctggggctcg gatttggcaa
     4141 ccatgatccg gtgtgctcga gcattcggag gcctaatgga tgaactcaaa gcacactgtg
     4201 tcacactccc tatcagggtt ggtatgaata tgaatgagga tggccccatc atcttcgaga
     4261 agcattccag gtacagatac cactatgatg ctgattactc tcggtgggat tcaacacaac
     4321 agagagccgt gctggcagct gctctagaaa tcatggttaa attctcctca gaaccacatt
     4381 tggctcaggt agtagcagaa gaccttcttt ctcctagcgt ggtggatgtg ggtgacttca
     4441 caatatcaat caacgagggc cttccctctg gggtgccctg cacctcccaa tggaactcca
     4501 tcgcccactg gcttctcact ctctgtgcac tctccgaagt tacaaatttg tccccagaca
     4561 tcatacaggc taattctctc ttctctttct atggtgatga tgaaattgtt agtacagata
     4621 taaaattaga cccagagaag ttgacagcaa agcttaagga atacgggttg aaaccaaccc
     4681 gccctgataa aactgaagga cctcttgtta tttctgaaga cttagatggt ttgactttcc
     4741 tgcggagaac tgtgacccgc gacccagctg gttggtttgg aaaactggag caaagctcaa
     4801 tactcaggca aatgtactgg actaggggcc ccaaccatga agatccatct gaatcaatga
     4861 ttccacactc tcaaagaccc atacaattga tgtccttact gggagaggcc gcactccacg
     4921 gcccaacatt ctacagtaaa atcagcaaat tagtcattgc agagttaaaa gaaggtggta
     4981 tggattttta cgtgcccagg caagagccaa tgttcaggtg gatgagattc tcagatctga
     5041 gcacgtggga gggcgatcgc aatctggctc ccagttttgt gaatgaagat ggcgtcgaat
     5101 gacgccaacc catctgatgg gtccgcagcc aacctcgtcc cagaggtcaa caatgaggtt
     5161 atggctttgg agcccgttgt cggtgccgct attgcggcgc ctgtagcggg ccaacaaaat
     5221 gtaattgacc cctggattag aaataatttt gtacaagccc ctggtggaga gttcacagta
     5281 tcccctagaa acgctccagg tgaaatacta tggagcgcgc ccttaggccc tgatctgaat
     5341 ccctacctat ctcatttggc cagaatgtat aatggttatg caggtggttt tgaagtgcag
     5401 gtgatcctcg cggggaacgc gttcaccgcc ggaaaaatta tatttgcagc agtcccacca
     5461 aattttccaa ctgaaggctt gagtcccagc caggtcacta tgttccccca cataatagtg
     5521 gatgttaggc aattggaacc tgtgttgatc cccttacctg atgttaggaa taacttctat
     5581 cattataatc agtcaaatga ttctaccatt aaattgatag caatgctgta tacaccactt
     5641 agggctaata atgctgggga agatgtcttc acagtctctt gtcgagttct cacaaggcca
     5701 tcccctgatt ttgattttat atttttggtg ccacctacag ttgagtcaag aactaaacca
     5761 tttactgtcc caatcttaac tgttgaagaa atgaccaatt caagattccc cattcctttg
     5821 gaaaaattgt tcacgggccc cagcagtgcc tttgttgttc aaccacaaaa tggcaggtgc
     5881 acgactgatg gtgtgctctt aggcaccacc caactgtctc ctgtcaacat ctgcaccttc
     5941 agaggggatg tcacccacat tgcaggttct cgtaattaca caatgaattt ggcttctcta
     6001 aattggaaca attatgaccc aacagaagaa attccagccc ctctaggaac tccagatttc
     6061 gtgggaaaga tccaaggtgt gctcactcaa accacaaagg gagatggttc gacccgtggc
     6121 cataaagcta cagtttacac tgggagtgcc ccctttactc caaagctggg cagtgttcaa
     6181 ttcagtactg atacagaaaa tgattttgaa actcaccaaa acacaaaatt taccccagtc
     6241 ggtgtcatcc aggatggtag caccacccac cgaaatgaac cccaacaatg ggtgctccca
     6301 agttattcag gtagaaatgt ccctaatgta cacctagccc ctgctgtagc ccccactttc
     6361 ccgggtgaac aacttctttt ctttaggtct actatgcccg gatgcagcgg gtatcccaac
     6421 atggatttgg attgcctact cccccaggag tgggtgcagc acttctacca agaggcagct
     6481 ccagcacaat ctgatgtggc tctattgaga tttgtgaatc cagacacggg tagggtcctg
     6541 tttgagtgca aacttcataa atcaggctat gtcacagtgg ctcacaccgg ccagcatgat
     6601 ttagtcatcc cccccaatgg ttattttagg tttgattcct gggttaatca attctacaca
     6661 cttgccccca tgggaaatgg aacggggcgt agacgtgctt tataatggct ggagctttct
     6721 ttgctggatt ggcatctgat gtccttagct ctggacttgg ttccctaatc aatgctgggg
     6781 ctggggctat caaccaaaag attgattttg aaaataacag aaaattgcag caagcttcct
     6841 tccagtttag cagtaatcta caacaggctt cctttcaaca tgataaagag atgctccaag
     6901 cacaaattga ggccactaaa aagttgcaac aggaaatgat gaaagtcaaa caggcaatgc
     6961 tcttagaagg tggattctct gaaacagatg cagcccgtgg ggcaatcaac gcccctatga
     7021 caaaggcttt ggactggagc ggaacaaggt actgggcccc tgatgctagg actacaacat
     7081 acaacgcggg ccgtttttcc acccctcaac cttcgggggt actgccagga agaaccaatc
     7141 ccaggactcc tacccccgct cggggctccc ccagcacatc ttctaatgct tctactgcta
     7201 cttctatata ttcaaatcaa actgtttcaa cgagacttgg ttctacagct ggttctggca
     7261 ccaatgtctc gagtctcccg tcaactgcaa ggactaggag ttgggttgag gatcaaaaca
     7321 gaaacttgtc acctttcatg aggggggctc acaacatatc gtttgtcacc cctccatcta
     7381 gcagatcctc tagccaaggc acagtctcaa ccgtgcctaa agaagttttg gactcctgga
     7441 ctggcgcttt caacacgcgc aggcagcctc tcttcgctca cattcgtagg cgaggggagt
     7501 cacgggtgta atgtgaaaag acaaaattga ttatctttcc ttttctttag tgtcc
//