Typing tool

Complete norovirus genomes

GU980585  GII.3
 GII.P12

Length: 7,577 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6731
ORF3: 6731..7495
LOCUS       GU980585                7577 bp    RNA     linear   VRL 10-AUG-2010
DEFINITION  Norovirus Hu/GII.3/CBNU1/2006/KOR, complete genome.
ACCESSION   GU980585
VERSION     GU980585.1
KEYWORDS    .
SOURCE      Norovirus Hu/GII.3/CBNU1/2006/KOR
  ORGANISM  Norovirus Hu/GII.3/CBNU1/2006/KOR
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7577)
  AUTHORS   Yun,S.I., Kim,J.K., Song,B.H., Jeong,A.Y., Jee,Y.M., Lee,C.H.,
            Paik,S.Y., Koo,Y., Jeon,I., Byun,S.J. and Lee,Y.M.
  TITLE     Complete genome sequence and phylogenetic analysis of a recombinant
            Korean norovirus, CBNU1, recovered from a 2006 outbreak
  JOURNAL   Virus Res. 152 (1-2), 137-152 (2010)
   PUBMED   20599576
REFERENCE   2  (bases 1 to 7577)
  AUTHORS   Yun,S.-I., Kim,J.-K., Song,B.-H., Jeong,A.-Y., Jee,Y.-M.,
            Lee,C.-H., Paik,S.-Y. and Lee,Y.-M.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-MAR-2010) Department of Microbiology, College of
            Medicine, Chungbuk National University, 12 Gaeshin-Dong,
            Heungduk-Ku, Cheongju-Si, ChungBuk 361-763, South Korea
FEATURES             Location/Qualifiers
     source          1..7577
                     /organism="Norovirus Hu/GII.3/CBNU1/2006/KOR"
                     /mol_type="genomic RNA"
                     /isolate="CBNU1"
                     /host="Homo sapiens"
                     /db_xref="taxon:863240"
                     /country="South Korea"
                     /collection_date="2006"
                     /note="genotype: GII.3"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ADK23786.1"
                     /translation="MKMASNDASAAAAADSNNDTAKSSSDGVLSSMAVTFKRALGARH
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVWQPD
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELAPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLCRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     VRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTALLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVVMISGRPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLLDTMRVGKQLKDVKTM
                     PELKQALKNVAIKSCQIVYGGCTYRLESDGKGDVKVDRVQNATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVEDTEETASKDGC
                     PKPKDDDEFVVSSDDIKTEGKKGKNKSGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNERLNFEAPPSIWSRIVSFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMRIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIVNVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMEELKAHCVTLPVRVGMNMNEDGPIIFERHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQKVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6731
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="ADK23787.1"
                     /translation="MKMASNDATPSNDGAAGLVPEISNEAMALDPVAGAAIAAPLTGQ
                     QNIIDPWIMNNFVQAPGGEFTVSPRNSPGEVLLNLELGPEINPYLAHLARMYNGYAGG
                     FEVQVVLAGNAFTAGKIIFAAIPPNFPIDNLSAAQITMCPHVIVDVRQLEPVNLPMPD
                     VRNNFFHYNQGSDSRLRLVAMLYTPLRANNSGDDVFTVSCRVLTRPSPDFSFNFLVPP
                     TVESKTKPFTLPILTISEMSNSRFPVPIDSLHTSPTENVVVQCQNGRVTLDGELMGTT
                     QLLPSQICAFRGVLTRSTSRASDQADTATPRLFNYYWHIQLDNLNGTPYDPAEDIPGP
                     LGTPDFRGKVFGVASQRNPDSTTRAHEAKIDTTAGRFTPKLGSLEISTESGDFDQNQP
                     TRFTPVGIGVDHEADFQQWSLPDYSGQFTHNMNLAPAVAPNFPGEQLLFFRSQLPSSG
                     GRSNGILDCLVPQEWVQHFYQESAPAQTQVALVRYVNPDTGRVLFEAKLHKLGFMTIA
                     KNGDSPITVPPNGYFRFESWVNPFYTLAPMGTGNGRRRIQ"
     CDS             6731..7495
                     /note="ORF3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ADK23788.1"
                     /translation="MAGAFIAGLAGDMFTNTVGSLVNAGANAINQKVDFENNKYLQNA
                     SFNHDKEMLNAQIEATKRLQADMIAIKQGVLTAGGFSPTDAARGAINAPMTKVLDWNG
                     TRYWAPNATSTTSMSGGFTNQAVHRTTPNFKTNQAPKSTPSSGSSVRSHSTQITNLSS
                     HSSGSSRSSGSTVVSSLPSSNRTRDWVNQQNFNLEPHMPGSLRTAFVTPPSSTASSSG
                     TVSTVPKNVLDSWTSAFNTRRQPLFAHLRRRGESNV"
     3'UTR           7496..7577
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgctgaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcataaac agcctccccc gagggaaata ccacaaaggc ctccacgacc
      181 acccacccca gaactggtca aaaagatccc tcctccccca cccaacgggg aggatgaact
      241 agtggtttct tacagcgcca aagatggcgt ttctggtttg cctgagctta ccactgtctg
      301 gcagccggat gaaaccaata cggcgttcag tgttccccca ctcaaccaga gggagaacag
      361 ggacgccaag gagccgctaa ccggaacaat cctggaaatg tgggacgggg agatctatca
      421 ttacggtctg tatgtggagc gaggtcttgt acttggtgtg cacaaaccac cagctgccat
      481 cagcctcgcc aaggttgaac tagcaccact ctctctgttt tggaggccag tgtacacacc
      541 acagtatctc atctctccag acactctcag gagactgcat ggagagtcgt tcccctacac
      601 agcctttgac aacaactgct atgccttctg ttgttgggtt ctggacctaa acgactcgtg
      661 gttgtgcagg agaatgatcc agaggacaac tggtttcttc agaccttacc aagactggaa
      721 caggaaaccc ctccccacca tggatgactc caaattgaag aaggtagcca acatattctt
      781 gtgtgcgcta tcttcgctat tcactaggcc catcaaagac ataataggaa aggtgagacc
      841 gcttaacatc cttaacatct tggcctcatg tgattggact tttgcaggca tagtggaatc
      901 tttgatcctc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgccccc ttactaggtg actacgaact gcaggggcct gaggaccttg cagtggaact
     1021 cgtaccagta gtgatggggg ggattggttt ggtgctagga ttcaccaaag agaagatcgg
     1081 aaaaatgttg tcatctgctg catccacctt aagagcttgt aaagaccttg gtgcatacgg
     1141 actggaaatc ctaaaattgg tcatgaagtg gttcttccca aagaaagagg aagcaaatga
     1201 gctggctatg gtgaggtcca tcgaggatgc ggtgctggac ctcgaagcaa ttgagaacaa
     1261 ccacatgact gccctcctca aagacaaaga cagcttggca acctacatga gaactcttga
     1321 cctcgaggag gagaaggcca ggaagctttc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gctctcctgg cgagaatcgc cgctgcacgt tccctggtgc atcgggcgaa
     1441 agaggaactc tctagcagac caagacctgt tgttgttatg atatcaggca ggccagggat
     1501 agggaaaact caccttgcca gggagctagc caagaaaatc gcagcttcgc ttacagggga
     1561 ccagcgtgtg ggtctcatcc ctcgcaatgg cgttgatcac tgggatgcat ataaggggga
     1621 aagagtcgtc ctatgggacg attatggaat gagtaatccc atccacgacg ccctcaggtt
     1681 acaggaactt gctgacacct gcccccttac gctaaactgt gacaggattg agaacaaagg
     1741 aaaggtcttt gacagtgatg ccataatcat caccactaat ctggccaacc cagcaccatt
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgac ttcctcgtgt acgcagaagc
     1861 ccctgaggtc gagaaggcaa agcgtgattt cccaggtcaa cctgacatgt ggaagaacgc
     1921 atttagttct gacttctcgc acataaaact ggcgctggct ccgcaaggtg gcttcgacaa
     1981 gaacggaaac accccacacg ggaaaggcgt tatgaaaacc ctcaccactg gttccctcat
     2041 cgcccgagca tcagggttac tccatgagag gttagatgag tatgagctgc agggcccaac
     2101 ccccaccacc tttaactttg accgcaacaa ggtgcttgcg ttcagacagc ttgctgccga
     2161 aaacaagtac ggattgttgg acacaatgag agttggaaaa cagctcaagg atgtcaagac
     2221 catgccagag ctcaaacaag cactcaagaa tgtcgcaatc aagagttgtc agatagtgta
     2281 tggtggctgc acttataggc ttgagtctga cggcaagggt gatgtgaaag ttgacagagt
     2341 tcagaacgcc actgtacaga ctaacaatga acttgccggc gccctacatc atcttaggtg
     2401 tgccagaatc agatattatg tcaagtgtgt ccaggaggcc ctgtattcca tcatccaaat
     2461 tgctggagct gcatttgtaa ccacgcgcat tgtcaagcgc atgaacatac aagatctctg
     2521 gtccaagcca caggtggagg atacagagga gaccgctagc aaggatgggt gcccaaaacc
     2581 caaggatgat gacgagttcg ttgtctcatc cgatgacatc aaaaccgagg gcaagaaagg
     2641 gaagaacaag tctggccgtg gtaagaagca cacagcattc tcaagtaaag gtctcagtga
     2701 tgaagagtac gatgagtaca aaagaatcag agaagaaaga aatggcaaat actccataga
     2761 ggaatacctc caggacaggg acaagtatta tgaggaggtg gccatcgcca gggcgaccga
     2821 agaggacttc tgtgaagaag aagaggccaa gatccgacaa aggattttca ggccaacaag
     2881 gaaacaacgc aaagaggaga gggcctctct cggtttggtc acaggctctg agatcaggaa
     2941 gaggaaccca gacgacttca agcctaaagg aaagctgtgg gctgatgacg acaggagtgt
     3001 tgactacaat gagagactca attttgaagc cccaccaagc atctggtcga ggatagtcag
     3061 ctttggttca ggttggggct tttgggtttc ccccagcctg ttcataacat caacccatgt
     3121 cataccccag ggcgcacagg agttctttgg tgttcccatc aaacaaattc agatacacaa
     3181 atcgggtgaa ttctgtcgtt tgaggtttcc aaagccgatc agaactgacg tgacaggcat
     3241 gatcttagaa gaaggtgcac ccgaagggac cgtggtcaca ctactcatca agaggccaac
     3301 tggagaactc atgcccctgg cagccagaat gggaacccat gcaaccatga ggattcaagg
     3361 gcgcactgtt ggaggtcaaa tgggcatgct tctaacagga tccaacgcta agagtatgga
     3421 cctgggcacc acaccaggtg actgtggttg tccctacatt tacaagaggg ggaatgacta
     3481 cgtagtcatt ggagtccaca cagctgccgc ccgtggagga aacaccgtca tttgtgccac
     3541 ccaggggagc gagggagaag ccacacttga aggcggtgac agcaagggga cctactgcgg
     3601 tgcaccaatc ttaggtccag gaagtgcccc aaagctcagc accaagacta aattctggag
     3661 gtcatccacg gcaccactcc cacctggtac ctatgagcca gcctacctcg gcggcaagga
     3721 ccccagagtt aagggtggcc cctcattgca acaagttatg agggaccaac tgaaaccatt
     3781 cactgagccc aggggtaaac caccaaaacc aagtgtgtta gaagctgcca agaaaaccat
     3841 cgtcaatgtc cttgaacaaa caattgatcc acctcaaaaa tggtcgtttg cgcaggcatg
     3901 cgcatccctt gacaagacca cttccagcgg tcacccgcac catatgcgga aaaacgactg
     3961 ctggaacggg gaatccttta caggaaaatt ggcagaccag gcttccaagg ccaacctgat
     4021 gttcgaggag ggaaagaaca tgaccccagt ctacacgggt gcgctcaagg acgagctggt
     4081 caagactgac aagatttatg gcaagatcaa aaagaggctt ctctggggtt cggacctggc
     4141 gaccatgatt cggtgcgctc gagcattcgg aggcctgatg gaggaactca aagcacattg
     4201 cgtcacacta cctgtcagag tgggcatgaa tatgaatgag gatggtccta tcatctttga
     4261 gagacactcc agatataaat accattatga tgctgattac tcccggtggg actcgacaca
     4321 acaaagagcc gtgttagcag cagccttaga aatcatggtc aagttctccc cagagccgca
     4381 tctggcccaa aaggttgcag aagaccttct ttctcccagc gtgatggacg tgggtgattt
     4441 caaaatatca attaatgagg gtctcccctc cggggtgccc tgcacctccc aatggaattc
     4501 catcgcccac tggctcctca ctctctgtgc actctctgag gttacaaacc tgtcccctga
     4561 cattattcag gctaactctc tcttttcttt ctacggtgat gatgaaattg tgagtacaga
     4621 cataaaattg gacccagaaa aactgacagc aaaactcaag gaatacgggt tgaaaccgac
     4681 ccgccctgac aagactgaag gaccccttgt catctctgaa gacctgaatg gcctaacctt
     4741 cctgcggagg accgtgaccc gcgacccagc aggctggttt ggaaagttgg aacagagttc
     4801 aatactcaga caaatgtatt ggactagggg ccccaaccat gaagacccat ctgaaacaat
     4861 gataccacac tcccagaggc ccatacaatt gatgtctttg ctgggtgagg ctgcactcca
     4921 cggcccagca ttctacagca aaatcagtaa actggtcatt gcagagttga aggaaggtgg
     4981 catggatttt tacgtgccaa gacaagagcc aatgttcaga tggatgaggt tctcggatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccac tccatctaat gatggtgccg ccggcctcgt cccagagatc agtaatgagg
     5161 caatggcgct agatccagtg gcgggtgcag cgatagcagc gcccctcact ggtcagcaaa
     5221 atataattga tccctggatt atgaataatt ttgtgcaagc acctggtggt gagtttacag
     5281 tatcccctag gaattcccct ggtgaagtgc ttctcaattt ggaattgggc ccagaaataa
     5341 atccctattt ggcccatctt gctagaatgt ataatggtta tgcaggtggg tttgaagtgc
     5401 aggtagtcct agctggaaat gcgtttacag caggaaagat aatctttgca gctatacccc
     5461 ctaatttccc aattgataat ctaagcgcag cacagatcac aatgtgccca catgtgattg
     5521 tggatgtcag acagttggaa ccggtcaacc ttccgatgcc tgacgttcgc aataacttct
     5581 tccactacaa ccaagggtct gattcgagat tgcgcttagt tgcaatgctg tatacacctc
     5641 ttagggcaaa taattctggg gatgatgttt ttactgtgtc ttgtagggtg ctgactaggc
     5701 ctagccctga cttttcattt aatttccttg tgccacctac tgtggagtca aagacaaaac
     5761 ccttcaccct ccctattctg actatctctg aaatgtccaa ttctaggttt ccagtgccga
     5821 ttgattctct gcacaccagc ccaactgaaa atgttgttgt ccagtgccaa aatggacgcg
     5881 tcactcttga tggtgagttg atgggcacca cccaactctt acctagtcaa atctgtgctt
     5941 ttaggggcgt gctcaccaga tcaacaagca gggccagtga ccaggccgac acagcaaccc
     6001 ctaggttgtt taattattat tggcacatac aattggataa tctaaatggg actccttatg
     6061 atcctgcaga agacatacca ggccccctag ggacaccaga tttccggggc aaagtctttg
     6121 gcgtggccag ccagagaaat cccgacagca caactagagc acatgaagca aagatagaca
     6181 caacagctgg tcgttttacc ccaaaactag gctcattaga gatatccact gaatctggtg
     6241 actttgatca aaaccaacca acaagattca ccccagttgg cattggggtt gaccacgagg
     6301 cagatttcca acaatggtct ttacccgact attctggtca gttcacccac aacatgaact
     6361 tagccccagc tgttgctccc aacttccctg gtgagcagct ccttttcttc cgctcacagt
     6421 taccatcttc tggtgggcga tccaacggga ttctagactg cctggtcccc caagaatggg
     6481 ttcagcactt ctaccaagaa tcggcccccg cccaaactca agtggccctg gttaggtatg
     6541 tcaaccctga cactggtaga gtgttgtttg aggccaagct gcacaaattg ggtttcatga
     6601 ctatagctaa gaatggtgac tctccaataa ctgtcccccc aaatggatac tttaggtttg
     6661 aatcttgggt gaacccattt tatacacttg cccccatggg aactgggaat gggcgtagaa
     6721 ggattcaata atggctggag cttttatagc aggattagct ggtgatatgt tcacaaacac
     6781 tgtaggatct ctagttaatg caggggctaa tgccattaat caaaaagttg attttgaaaa
     6841 caataaatat ttgcaaaatg cttcctttaa tcatgataag gaaatgttaa atgcacaaat
     6901 tgaggcaaca aagaggttac aggctgacat gattgctatc aaacaagggg ttttgaccgc
     6961 tggcggcttt tctcctactg atgcagcccg cggggcaatt aatgccccca tgacaaaagt
     7021 cctagattgg aatggaacga ggtactgggc accaaatgcc acctctacaa cctcgatgtc
     7081 gggtggcttc acaaaccagg ctgtgcacag aaccacgcca aattttaaaa cgaaccaggc
     7141 ccccaaatcc acacccagca gtgggtcttc agtgaggtca cactcaaccc aaatcactaa
     7201 tctgagctca cactcgtccg ggtcgtctcg atccagcggg tctacagttg ttagctcatt
     7261 accatcctct aacaggacta gggactgggt caaccaacaa aattttaatt tggaaccaca
     7321 catgcctgga tcccttagga cagcttttgt tactccacca tctagtacag cctctagttc
     7381 aggcactgtc tcaaccgtgc ccaaaaatgt tttggactcc tggacatctg cgttcaatac
     7441 gcgcagacag ccgctattcg cacaccttcg tagaaggggg gagtcaaatg tttagtgaaa
     7501 agattacttt aaatttggtt taaattggat ttgattagga atcttttaaa aaaaaaaaaa
     7561 aaaaaaaaaa aaaaaaa
//