Typing tool

Complete norovirus genomes

GU325839  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,560 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       GU325839                7560 bp    RNA     linear   VRL 06-SEP-2011
DEFINITION  Norovirus Hu/GII.4/HS194/2009/US, complete genome.
ACCESSION   GU325839
VERSION     GU325839.2
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/HS194/2009/US
  ORGANISM  Norovirus Hu/GII.4/HS194/2009/US
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7560)
  AUTHORS   Takanashi,S., Wang,Q., Chen,N., Shen,Q., Jung,K., Zhang,Z.,
            Yokoyama,M., Lindesmith,L.C., Baric,R.S. and Saif,L.J.
  TITLE     Characterization of Emerging GII.g/GII.12 Noroviruses from a
            Gastroenteritis Outbreak in the United States in 2010
  JOURNAL   J. Clin. Microbiol. 49 (9), 3234-3244 (2011)
   PUBMED   21752978
REFERENCE   2  (bases 1 to 7560)
  AUTHORS   Chen,N., Wang,Q. and Saif,L.J.
  TITLE     Sequence analysis of the complete genome of a GII.4 Norovirus
            strain
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 7560)
  AUTHORS   Wang,Q., Zhang,Z. and Saif,L.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-DEC-2009) Food Animal Health Research Program,
            OARDC/The Ohio State University, 1680 Madison Ave., Wooster, OH
            44691, USA
REFERENCE   4  (bases 1 to 7560)
  AUTHORS   Chen,N., Wang,Q. and Saif,L.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-MAY-2011) Food Animal Health Research Program,
            OARDC/The Ohio State University, 1680 Madison Ave., Wooster, OH
            44691, USA
  REMARK    Sequence update by submitter
COMMENT     On May 26, 2011 this sequence version replaced GU325839.1.
FEATURES             Location/Qualifiers
     source          1..7560
                     /organism="Norovirus Hu/GII.4/HS194/2009/US"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/HS194/2009/US"
                     /host="Homo sapiens"
                     /db_xref="taxon:706195"
                     /country="USA"
                     /collection_date="2009"
                     /note="genotype: GII.4"
     CDS             5..5104
                     /note="orf1; encodes 2C helicase, 3C protease, and 3D
                     RNA-dependent RNA polymerase"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AEG64833.1"
                     /translation="MKMASNDASAAAVANSNNDTAKSSNDKMFSNMAVTLKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEAVISYSAKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATSKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="major structural protein; orf2"
                     /codon_start=1
                     /product="capsid protein VP1"
                     /protein_id="ADB27914.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSADFTPKLGSVQFGTDTENDFETHQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNVHNVHLAPAVAPNFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="minor structural protein; orf3"
                     /codon_start=1
                     /product="small basic protein VP2"
                     /protein_id="ADB27915.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFNSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARITTYNAGRFSTPQPSGALPGRINPRTPTPARGSPSISS
                     NASTATSIYSNQTVSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRKQPLFAHIRRRGESRV"
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgccaaca gcaacaacga
       61 caccgcaaaa tcttcaaatg acaaaatgtt ttctaacatg gctgtcactc ttaaacgagc
      121 cctcggggcg cggcctaaac agcccccccc gagggaaata ccacaaagac ccccacgacc
      181 acctactcca gaactggtca aaaagatccc tcctccccca cccaacggag aggatgaagc
      241 agtgatttct tatagtgcca aagatggcgt ttccggtttg cctgagcttt ccaccgtcag
      301 gcaaccggaa gaaaccaata cggccttcag tgtccctcca ctcaatcaga gggagaatag
      361 ggatgctaag gaaccactga ctggaacaat tctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgttgagc gaggtcttgt gctgggtgta cacaaaccac cagctgccat
      481 tagcctcgcc aaggtcgaac taacaccact ctccttgttc tggagacctg tgtacactcc
      541 tcagtacctc atttctccag acactctcaa gaaattacac ggagaaacat ttccctacac
      601 agcctttgac aacaattgct atgccttttg ttgctgggtc ctggatctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgattc caaattaaag aaggtagcta acatattcct
      781 gtgcgccctg tcttcgctat tcaccaggcc cataaaagac ataataggaa agttaaggcc
      841 tctcaatatc atcaacatcc tggcttcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ttggcagagc tctttggagt cttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg atttcgagtt acaaggacct gaggaccttg tagtggagct
     1021 cgtccctgta gtaatggggg ggattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catccacctt gagagcttgt aaagaccttg gtgcatatgg
     1141 gctagagatc ctaaagttag tcatgaagtg gttcttcccc aagaaagagg aagcgaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtactggac cttgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagcctggca acctacatga gaaccctcga
     1321 cctcgaggaa gagaaagcca gaaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc cgctgcacgt tctctggtgc accgagcgaa
     1441 ggaggagctt tccagcagac caagacctgt agtcttgatg atatcaggca ggccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc tcacaggaga
     1561 ccagcgtgta ggcctcattc cacgcaatgg cgtcgatcac tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagcaatccc atccacgacg ccctcaggct
     1681 gcaagaactc gctgacactt gccccctcac tctaaattgt gacaggattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcatcattat cactactaat ctggccaacc cagcaccact
     1801 ggactatgtc aactttgaag cgtgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccccgaggtc gaaaaggcga agcgcgactt cccgggccaa cctgacatgt ggaaaaacgc
     1921 ttttagttct gatttctcac acataaaatt ggcactggct ccacaaggtg gctttgacaa
     1981 gaacgggaac accccacacg ggaagggcgt catgaagact ctcaccactg gctccctcat
     2041 tgcccgggcg tcagggctgc tccatgagag attggatgag tttgaactac agggcccagc
     2101 tctcaccacc ttcaactttg accgcaacaa agtgcttgcc ttcaggcagc ttgctgctga
     2161 aaacaaatat gggttgatgg acacaatgaa agttgggagg cagctcaagg acgtcaaaac
     2221 catgccagaa cttaaacaag cactcaagaa tatctcaatc aagaagtgcc agattgtgta
     2281 cagtggttgc acctacacac ttgagtctga tggcaagggc aatgtgaaag ttgacagagt
     2341 tcagagtacc tccgttcaga ccaacaatga gctggctggc gccctgcacc atctaaggtg
     2401 cgccagaatc aggtactatg tcaagtgtgt tcaggaggcc ctgtattcta tcatccagat
     2461 tgctggggcc gcatttgtca ccacgcgcat catcaagcgt gtgaacattc aagacttatg
     2521 gtccaagcca caagtggaaa acacagagga ggctaccagc aaggacgggt gcccaaaacc
     2581 caaagatgat gaggagttcg tcatttcatc tgacgacatt aaaactgagg gtaagaaagg
     2641 gaagaacaag actggccgtg gcaagaagca cacagccttc tcaagtaaag gtctcagtga
     2701 tgaagagtat gatgagtaca agagaattag agaggaaaga aatggcaagt actccataga
     2761 agagtacctc caggacaggg acaaatacta tgaggaggtg gccattgcca gggctaccga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcag aggatcttca gaccaacaag
     2881 gaaacaacgc aaggaagaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 aagaaatcca gaagacttca agcccaaggg gaaactatgg gctgacgatg acagaagtgt
     3001 ggactacaat gaaaagctca gttttgaggc cccaccaagc atctggtcaa ggatagtcaa
     3061 ctttggctca ggttggggct tctgggtctc ccccagccta ttcataacat caacccacgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaattc aggtgcacaa
     3181 gtcaggcgaa ttctgtcgct tgaggttccc aaaaccaatc aggactgatg tgactggcat
     3241 gatcttggaa gaaggtgcgc ccgaaggcac cgtggtcaca ctactcatca aaagacccac
     3301 tggagaactc atgcccctag cagctagaat ggggacccat gcaaccatga agattcaagg
     3361 gcgcactgtt ggaggtcaga tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 tctaggcacc acaccaggtg attgcggctg tccctacatc tacaagagag gaaacgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 ccaggggggt gagggggagg ctacacttga aggtggtgac agtaagggaa catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaaaacca aattctggag
     3661 atcatccaca gcaccactcc cacctggcac ctatgaacca gcctaccttg gtggcaaaga
     3721 ccccagagtc aagggtggcc cctcgttgca gcaagtcatg agggaccagc tgaaaccatt
     3781 tacagagcct aggggtaagc caccaaagcc aagtgtgtta gaagctgcca agaaaaccat
     3841 catcaatgtc cttgaacaga caattgaccc acctgagaag tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttctagcgg ccacccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gaatctttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgaccccagt ctacacaggt gcacttaagg atgaattagt
     4081 caaaactgac aaaatttatg gtaagatcaa gaagagactt ctctggggct cggacttagc
     4141 aaccatgatc cggtgtgctc gagcattcgg aggtctgatg gatgaactca aagcacactg
     4201 tgtcacactt cctgtcagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaagcattcc aggtacagat accactatga tgctgattac tctcggtggg attcaacaca
     4321 acagagagcc gtgctggcag ctgctctaga aatcatggtt aaattctcct cagaaccaca
     4381 cttagctcag gtagtagcag aagaccttct ttctcctagc gtggtagatg tgggcgactt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc actctccgaa gtcacaaatt tgtccccaga
     4561 catcatacag gctaattctc tcttctcctt ctatggtgat gatgaaattg ttagtacaga
     4621 cataaaatta gacccagaga agttgacagc aaagcttaag gaatatgggt tgaaaccaac
     4681 ccgccctgac aaaactgaag gaccccttgt tatttctgaa gacttagacg gtttgacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagctc
     4801 aatactcagg caaatgtact ggactagggg ccccaatcat gaagacccat ctgaatcaat
     4861 gatcccacac tctcaaagac ccatacaatt gatgtcctta ctgggagagg ccgcactcca
     4921 cggcccaaca ttctacagta aaatcagcaa attagtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcggatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gtcggtgccg ctattgcggc gcctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagttcacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttgggc cccgatctga
     5341 atccctacct atcacatttg gccagaatgt ataatggtta tgcaggtggt tttgaagtgc
     5401 aggtgatcct cgcggggaac gcgttcaccg ccggaaaaat tatatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ctgagtccca gccaggttac tatgttcccc cacataatag
     5521 tagatgttag gcaattggaa cctgtgttga tccccttacc tgatgttagg aataacttct
     5581 atcattataa tcagtcaaat gattccacca ttaaattgat agcaatgctg tatacaccac
     5641 ttagggccaa taatgctggg gatgatgtct tcacagtctc ttgtcgagtc ctcacgaggc
     5701 catcccctga ttttgacttt atatttttgg tgccacctac agttgagtca agaactaagc
     5761 catttactgt cccaatctta actgttgaag aaatgactaa ttcaagattc cccattcctt
     5821 tggaaaaatt gttcacgggt cccagcagtg cctttgttgt tcaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ttaggcacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac attgcgggtt ctcgcaatta cacaatgaat ttggcatctc
     6001 taaattggaa caattatgac ccaacagaag aaattccagc ccctctggga actccagatt
     6061 tcgtgggaaa gatccaaggt gtgctcactc agacaacaaa gggagatggc tcgacccggg
     6121 gccataaagc tacagtttac actgggagtg ccgactttac tccaaagctg ggcagtgttc
     6181 aatttggtac tgatacagaa aatgactttg aaactcacca aaacacaaaa ttcaccccag
     6241 tcggtgtcat ccaggatggt agcaccaccc accgaaatga accccaacaa tgggtgctcc
     6301 caagttattc aggcagaaat gtccataatg tgcacttagc ccctgctgta gcccccaatt
     6361 ttccgggtga acaacttctt ttcttcaggt ccactatgcc cggatgcagc gggtatccca
     6421 acatggattt ggactgccta ctcccccagg agtgggtgca gcacttctat caagaggcag
     6481 ctccagcaca atctgatgtg gctctattga gatttgtgaa tccagacacg ggtagagtcc
     6541 tgtttgagtg caaacttcat aaatcaggct atgtcacagt ggctcacacc ggccaacatg
     6601 atttggtcat cccccccaat ggctatttta gatttgattc ctgggttaat caattctaca
     6661 cacttgcccc catgggaaat ggaacggggc gtagacgtgc tttataatgg ctggggcttt
     6721 ctttgctgga ttggcatctg atgtccttag ctctggactt ggttccctaa tcaatgctgg
     6781 ggctggggcc atcaaccaaa agattgattt tgaaaataat agaaaattgc agcaagcttc
     6841 tttccagttt aacagtaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacta aaaagttgca gcaggaaatg atgaaagtca aacaggcaat
     6961 gctcttagaa ggtggattct ctgaaacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaggct ttggactgga gcggaacaag gtactgggcc cctgatgcta gaattacaac
     7081 atacaatgca ggccgctttt ccacccctca accttcgggg gcgctgccag gaagaatcaa
     7141 tcccaggact cctacccccg ctcggggctc ccccagcata tcttccaatg cttctactgc
     7201 tacttctata tactcaaatc aaactgtttc aacgagactt ggttctacag ctggttctgg
     7261 caccagtgtc tcgagtctcc cgtcaactgc aaggactagg agttgggttg aggatcaaaa
     7321 cagaaatttg tcacctttca tgaggggggc tcacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tccagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaagcagcc tctcttcgct cacatccgta ggcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt ccttttcttt agtgtctttt
//