Typing tool

Complete norovirus genomes

GU292831  GII.16
 GII.P16

Length: 7,577 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6701
ORF3: 6701..7498
LOCUS       GU292831                7577 bp    RNA     linear   VRL 22-APR-2019
DEFINITION  Norovirus GII strain
            Hu/GII.P16-GII.16/RUS/Novosibirsk/Nsk-410/2005, complete genome.
ACCESSION   GU292831
VERSION     GU292831.4
KEYWORDS    .
SOURCE      Norovirus GII
  ORGANISM  Norovirus GII
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7577)
  AUTHORS   Zhirakovskaia,E.V., Tikunov,A.Y., Bodnev,S.A., Klemesheva,V.V.,
            Netesov,S.V. and Tikunova,N.V.
  TITLE     Molecular epidemiology of noroviruses associated with sporadic
            gastroenteritis in children in Novosibirsk, Russia, 2003-2012
  JOURNAL   J. Med. Virol. 87 (5), 740-753 (2015)
   PUBMED   25693507
REFERENCE   2  (bases 1 to 7577)
  AUTHORS   Zhirakovskaya,E. and Tikunova,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-DEC-2009) Siberian Branch of Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine,
            Lavrentiev Ave. 8, Novosibirsk 630090, Russia
REFERENCE   3  (bases 1 to 7577)
  AUTHORS   Zhirakovskaya,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2018) Siberian Branch of Russian Academy of
            Sciences, Institute of Chemical Biology and Fundamental Medicine,
            Lavrentiev Ave. 8, Novosibirsk 630090, Russia
  REMARK    Sequence update by submitter
COMMENT     On Apr 22, 2019 this sequence version replaced GU292831.3.
FEATURES             Location/Qualifiers
     source          1..7577
                     /organism="Norovirus GII"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.P16-GII.16/RUS/Novosibirsk/Nsk-410/2005"
                     /isolate="GII.16/Nsk-410/2005/RUS"
                     /isolation_source="feces"
                     /host="Homo sapiens; sex: F; age: 9 months"
                     /db_xref="taxon:122929"
                     /country="Russia: Novosibirsk"
                     /collection_date="02-Aug-2005"
                     /note="genotype: GII.P16/GII.16"
     5'UTR           1..4
     gene            5..5098
                     /gene="ORF1"
     CDS             5..5098
                     /gene="ORF1"
                     /codon_start=1
                     /product="nonstructural polyprotein"
                     /protein_id="AZL94853.1"
                     /translation="MKMASNDATVAVACDNNNDKEKSSGEGLFTNMSSTLKKALGARP
                     KQPAPRDNSQKPPRPPTPELVKRIPPPPPNGEEEPAVRFEVKSGISGLPELTTVPQLD
                     VTNTAFSVPPLSLRENKEAKEPLTGAILEMWDGEIYHYGLYVEKGLVLGVHKPPAAIS
                     MARVEMTPLSLYWRVVYTPQYLISPDTLKRLNGEAFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMVQRTTGFFRPYQEWNRKPLPTMDDSKIKKVANIFLCSLSTLFTRPIKDIIGK
                     IKPLNILNILATCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGEYELQGPED
                     IAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEASELAMVRAIEDAVLDLEAIENNHMTTLLKDKDSLATYMKTLDLEEEKARRLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAREV
                     AKKVASTLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRIQELADTC
                     PLTLNCDRIENKGKVFDSEVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKDAFKADFSHIKLQLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERMDEFELQGPTTTTFNFDRNRITAFRQLAAENKYGLVDTMRVGNQLKGVKTM
                     EELKQAIKNVSIKRCQIIYNGSTFDLESDGKGKVLVEKVKNTSVQTNNELAGALHHLR
                     SARIRYYVKCVQEAVYSILQIAGAAFVTTRIARRMNIQELWSKPPLDQSEPETKEEAP
                     KLEDDEFIISSKDIKEEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNGKY
                     SIEEYLQDRDRYYEELAIAKATEEDFCEEEEIKIRQRIFRPTRKQRKEERATLGLVTG
                     SEIRKRNPDDFKPKGRLWADDNRSVDYNEKLDFEAPPSIWSRIVSFGSGWGFWVSPSL
                     FITSTHVIPAGITEAFGVPIKQVQVHKSGEFCRFRFPKPIRPDVTGMILEEGAPEGTV
                     ATVLIKRPTGELMPLAARMGTHATMRIQGRMVGGQMGMLLTGSNAKGMDLGTTPGDCG
                     CPYIYKRGNDYIVIGVHTAAARGGNTVICATQGSEGEATLEGGDDKGTYCGAPILGPG
                     GAPKLSTKTKFWRSSNTPLPPGTYEPAYLGGRDPRVKGGPSLQQVMRDQLKPFTEPRG
                     KPPRPSVLEAAKQTIINVLEQTLDPPQKWTYAQACASLDKTTSSGHPHHARKNEFWNG
                     ETFIGKLADQASKANLMYEEGKHMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDLST
                     MVRCARAFGGLMDEMKAHCISLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWDST
                     QQRAVLAAALEIMVRFSAEPQLAQTVAEDLLAPSVVDVGDFKISINEGLPSGVPCTSQ
                     WNSITHWLLTLCALSEVTNLSPDIVQANSMFSFYGDDEIVSTDIKLDPEKLTTKLREY
                     GLKPTRPDKTEGPLIISEDLDGLTFLRRTVSRDPAGWFGKLDQSSILRQMYWTRGPNH
                     EDPNETMIPHSQRPIQLMALLGEASLHGPSFYSKISKLVITELKEGGMDFYVPRQEPM
                     FRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     mat_peptide     5..994
                     /gene="ORF1"
                     /product="p48"
     mat_peptide     995..2092
                     /gene="ORF1"
                     /product="NTPase"
     mat_peptide     2093..2623
                     /gene="ORF1"
                     /product="p22"
     mat_peptide     2624..3022
                     /gene="ORF1"
                     /product="VPg"
     mat_peptide     3023..3565
                     /gene="ORF1"
                     /product="Pro"
     mat_peptide     3566..5095
                     /gene="ORF1"
                     /product="RNA-dependent RNA polymerase"
     gene            5079..6701
                     /gene="ORF2"
     CDS             5079..6701
                     /gene="ORF2"
                     /codon_start=1
                     /product="major capsid protein VP1"
                     /protein_id="AZL94854.2"
                     /translation="MKMASNDAAPSNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQ
                     NNVIDPWIRLNFVQAPNGEFTVSPRNSPGEVLLNLELGPELNPYLAHLARMYNGYAGG
                     VEVQVLLAGNAFTAGKLVFAAIPPHFPVDNLSPGQITMFPHVIIDVRTLEPVLLPLPD
                     VRNNFFHYNQQSDQRMRLIAMLYTPLRSNGSGDDVFTVSCRVLTRPSPDFDFNYLVPP
                     TVESKTKPFSVPVLTLNELTNSRFPVPIDAMYTSPNDSIVVQPQNGRATIDGELLGTT
                     QLIPSGICSFRGKITTHLSDDRHLWNIQVSNLNGTPFDPTDDVPAPLGMPDFSGQIFG
                     VVSQRDTGTNPANRAHDAVLATYSAKYTPKLGSVQIGTWDTEDLLERQPVKFTPVGLN
                     EIGQDKHFDQWVLPNYSGALGLNMHLAPAVSPLFPGERLLFFRSYIPLKGGHGDPFID
                     CLVPQEWIQHFYQESAPAQSSVALLRYVNPDTGRTLFEAKLHKEGFITVSSTENRPVI
                     VPPNGYFRFDSWVNQFYSLAPMGTGNGRRRMQ"
     gene            6701..7498
                     /gene="ORF3"
     CDS             6701..7498
                     /gene="ORF3"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="QCD16863.1"
                     /translation="MAGAFIAGLAGDIVTNGIGSLVNAGANAINQKVDFENNKQLQQA
                     SFNHDKEMLQAQIQATKQLQADMISIRQGVLSAGGFSPTDAARGAVNAPMTQVLDWNG
                     TRHWAPGAPRTTSFSGGFTNSTRARTVEPPKSSPPVQNTLISASRPSSTVSSSSTRST
                     VVTSSSTAPSVRSSVTRNSPRSASQSVSSASSRTGDWVQNQNRMLEPYLRGSLQTAFV
                     SPPSSKASSNGTVSTVPKEVLDSWTSAFNTRRQPLFAHLRRRGESQA"
     3'UTR           7499..7577
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgctac cgttgccgtt gcttgcgaca acaacaacga
       61 caaggaaaaa tcttcgggtg aaggcttatt tacaaatatg tcttccaccc taaagaaagc
      121 cctcggggcc cggcccaaac agcctgcccc gagggacaac tcacaaaagc ccccaagacc
      181 acctacgccc gagttggtta agagaatacc ccctcctcca cccaatggcg aagaagaacc
      241 agccgttagg tttgaggtta agagtggaat ctctggtctg cctgagctca cgacagttcc
      301 ccaactggat gtgaccaaca cggcattcag tgtcccaccg ctgagcttga gagaaaacaa
      361 ggaggccaag gaaccgctga ctggggcaat attagagatg tgggatggag agatatacca
      421 ctatggtttg tatgtggaga aaggcttagt gttgggtgtg cacaaaccac ctgcagctat
      481 aagtatggca agggtggaaa tgacgccgct gtcattatat tggcgtgtgg tgtacacccc
      541 ccaatacctc atttcccccg acactctcaa gaggcttaac ggggaggcat tcccttacac
      601 tgcctttgac aacaactgtt atgccttttg ttgctgggtg ttagacctta atgactcatg
      661 gctcagcaga aggatggtgc aaagaacaac aggcttcttc agaccctacc aagagtggaa
      721 cagaaaaccc ctacccacta tggatgactc aaaaattaag aaggtggcaa acattttctt
      781 atgttcattg tccacactgt tcaccagacc tataaaagac atcataggga aaatcaaacc
      841 actgaatatt ttgaacattc tggcaacgtg tgactggacg ttcgccggaa tcgtagagtc
      901 tctaatacta cttgctgaac tctttggagt tttctggaca cccccagatg tgtctgctat
      961 gatcgccccc ttacttggcg aatacgagct acaagggccc gaagacatcg ccgttgagct
     1021 cgtacctgta gtaatgggag ggattggctt ggtgctagga ttcaccaaag agaaaattgg
     1081 caaaatgcta tcctcagcag catcaacgct cagggcttgc aaagaccttg gtgcttatgg
     1141 tttagagata ctcaaattgg ttatgaaatg gtttttccca aagaaagaag aggccagtga
     1201 actagccatg gtgagggcaa tagaggatgc tgtactggat cttgaagcga tagaaaacaa
     1261 ccacatgaca actctgctga aagataaaga cagccttgca acctacatga agacactgga
     1321 cctagaggaa gaaaaagcca ggagattgtc cacaaaatct gcatcccctg acatagttgg
     1381 aacaatcaat gccctgctgg ctcgaatagc agcggctaga tcactagtcc acagggccaa
     1441 agaggaactg tctagcagga tcaggccagt tgttgttatg atttctggca agccagggat
     1501 aggcaagact cacctagcca gggaggtggc gaaaaaggtg gcatccactc tcacggggga
     1561 tcaaagagtc ggactcatac cgagaaacgg tgtagaccat tgggatgcat acaaaggtga
     1621 gagggtcgtg ttgtgggacg actacggcat gagtaacccc atccatgatg ctctgcgcat
     1681 acaggaattg gccgacacat gtcccctcac cttaaattgt gacagaattg aaaataaggg
     1741 aaaagttttt gatagtgaag tcataataat cacaacaaac ctcgccaatc cagctcccct
     1801 tgattatgtc aactttgagg cctgttccag gagaattgac ttcctggtat acgccgaagc
     1861 accagaagtg gaaaaggcaa aacgagactt ccctggtcag ccagatatgt ggaaggacgc
     1921 cttcaaagcg gacttttcgc atatcaagtt acaacttgcg cctcagggcg gttttgacaa
     1981 gaacggcaac accccacatg gtaaaggagt gatgaagacc ctcaccactg gttctctgat
     2041 tgcccgtgcg tcaggtttac tacatgagag gatggatgaa tttgaactcc agggccctac
     2101 aaccaccact ttcaatttcg accgaaacag aatcaccgcc tttagacaac tggctgcaga
     2161 aaacaagtat gggttggtgg acaccatgag agttggcaac caactgaaag gggtgaaaac
     2221 catggaagaa ctcaagcaag caatcaagaa tgtgtccatc aagaggtgcc agattatcta
     2281 taatggctcc acgttcgacc ttgagtctga tggtaagggc aaggttttag tggaaaaggt
     2341 taaaaacacc tccgtccaga ccaacaacga gctggccgga gccctgcatc acctcagaag
     2401 tgctcgaatc aggtattatg tcaaatgtgt gcaagaagca gtctactcca tcctacaaat
     2461 tgccggcgct gcgttcgtca ccacacgtat tgcacgccgt atgaacatac aagaactttg
     2521 gtcaaagcca ccattagacc aaagtgagcc agagaccaaa gaagaggccc ccaagttaga
     2581 agatgatgag ttcattatat cctccaaaga catcaaggag gaaggaaaga agggcaaaaa
     2641 caagactggc cgtggcaaga aacacactgc attctcgagc aagggcttga gcgatgagga
     2701 gtatgacgag tacaagagaa taagagaaga gagaaatgga aagtactcta tagaggagta
     2761 tctccaagac agagacaggt actatgagga gctcgccatc gccaaggcca cggaagaaga
     2821 cttctgcgag gaagaagaaa ttaaaatccg ccagaggatc ttccgcccta ccagaaaaca
     2881 aaggaaggaa gaaagggcca cgctaggact agtgactggt tcagaaatca gaaagagaaa
     2941 ccctgatgac ttcaaaccta aagggaggtt gtgggccgac gacaacagaa gtgttgacta
     3001 caatgaaaag ttggactttg aggccccccc aagcatatgg tccaggattg tgagctttgg
     3061 ttccggttgg ggcttctggg tgtcaccaag cctgttcata acatcaactc atgtaatccc
     3121 tgcgggcata acagaggcat ttggagtccc catcaaacaa gtccaagtcc acaaatcagg
     3181 tgagttttgc cggttcagat tcccaaaacc aattagacca gatgtgacag gaatgatcct
     3241 ggaagagggt gcgccagagg gcactgtggc aaccgtacta atcaaacgcc ccaccggaga
     3301 actcatgccc ctcgcagcca gaatgggaac acacgcgacc atgagaattc agggccgcat
     3361 ggttggcggg cagatgggca tgttgctcac tggttcaaat gctaagggta tggatttggg
     3421 aacaactccc ggtgactgtg gctgcccgta catctacaaa aggggcaatg actatatagt
     3481 cattggagtg cacacagcag cagcccgtgg tggaaatact gtcatctgcg ccacacaggg
     3541 aagtgagggt gaagcgactc tcgagggtgg agacgacaaa ggaacatact gcggggcacc
     3601 cattctgggc cctggaggag caccaaaatt gagcaccaaa accaaatttt ggaggtcatc
     3661 aaacacgccc ctcccaccag ggacgtatga gcctgcctat cttggtggtc gtgacccgcg
     3721 tgtaaagggc ggaccctctt tgcagcaagt catgagagat cagttgaagc ccttcactga
     3781 gcccaggggt aaacctccaa gacctagtgt gttggaggca gctaaacaaa ccatcatcaa
     3841 cgtccttgag caaactctgg atcccccaca aaagtggaca tacgcacagg cgtgtgcttc
     3901 gcttgataag accacctcta gtgggcaccc ccatcacgcc cgaaagaatg aattctggaa
     3961 tggtgagacc tttattggca agttggcaga ccaagcatca aaagcaaacc tgatgtatga
     4021 ggaagggaaa cacatgacac cagtgtacac agcagccctc aaggacgagt tggtaaaaac
     4081 tgacaaaatc tatgggaaga tcaagaagag gctgctttgg ggctctgact tgtccaccat
     4141 ggtccgatgt gctagggcct ttggtgggct catggatgag atgaaggcac actgcatatc
     4201 actcccagtc cgagtcggta tgaacatgaa tgaggatggt ccaataatat ttgagaagca
     4261 ttccagatat aagtaccatt atgatgcaga ctactcccgc tgggattcaa cacaacaaag
     4321 ggctgttcta gcagcggctt tggaaataat ggtcagattc tctgcagaac cacaactggc
     4381 acaaacagtc gctgaagacc tgctggcccc tagtgtggta gatgtaggag acttcaaaat
     4441 ttcaataaat gaggggcttc cttctggtgt accatgcact tcccagtgga actccatcac
     4501 acattggctg ttaactctct gtgctttgtc tgaagtcacc aacctgtccc ctgacatcgt
     4561 gcaggcaaat tccatgttct cgttttacgg tgatgacgag attgtcagca ccgatataaa
     4621 attagaccct gaaaagttaa ccaccaaatt gagggaatat ggtctgaaac caacccgccc
     4681 agataaaact gagggaccac tgattatcag cgaggatttg gacggactca ccttcctccg
     4741 gaggacagtt tcccgtgacc cagctggctg gtttggaaag ttagatcaaa gctcaatact
     4801 aaggcagatg tactggacca gaggaccaaa ccatgaagac cccaatgaaa caatgatacc
     4861 ccactctcaa agacccatac agcttatggc actgcttggt gaggcttccc ttcatggacc
     4921 ctctttctac agcaaaatta gtaaattggt cataactgaa ctcaaagaag gtgggatgga
     4981 tttttacgtg ccgaggcagg aacctatgtt caggtggatg aggttttctg acttgagcac
     5041 gtgggagggc gatcgcaatc tggctcccag ttttgtgaat gaagatggcg tcgaatgacg
     5101 ccgctccatc taatgatggt gcagccggtc tcgtaccaga ggtcaacaac gagacaatgg
     5161 cacttgaacc agttgcggga gcttcaattg ctgccccttt aactggtcaa aataatgtaa
     5221 tagacccctg gattagatta aattttgtac aagcccccaa tggtgagttc acggtttccc
     5281 cccgaaactc gcctggtgaa gttttgttaa atttggagtt agggcctgaa ttgaatccat
     5341 acttagccca tttagcaaga atgtataatg gttatgcagg tggggttgag gtgcaggtac
     5401 tgctggctgg aaatgcgttt acagcaggca aactggtatt tgcagcaatc ccccctcatt
     5461 ttccagtaga taatttgagc cctggtcaga ttactatgtt cccccatgtg attattgatg
     5521 ttagaacact tgagcctgtc ttattaccat tacctgatgt taggaataat ttctttcatt
     5581 ataatcagca gagtgatcag cgcatgaggc ttattgctat gctttatacc ccccttagat
     5641 ctaatggttc aggtgatgat gtctttactg tttcatgtag ggtcctaacc aggccatccc
     5701 ctgactttga ttttaattat ttggttcctc caacagttga atctaaaact aaacccttct
     5761 cagtcccagt gctgaccctt aatgaactga ccaattctcg atttcctgtc ccgattgatg
     5821 ccatgtacac tagccctaat gattcaattg tggtccaacc ccaaaatgga agggcaacca
     5881 tagacggtga gttgcttggc accacccaac tcatccccag tggtatctgc tcatttagag
     5941 ggaaaatcac aacacacttg tcagatgaca ggcacttgtg gaacatccaa gtctccaatt
     6001 tgaatggcac tccgtttgac ccaacagacg acgtgcccgc accattgggt atgccagact
     6061 tttctggaca aatatttggg gtagttagtc aaagggacac aggcaccaac cccgcaaaca
     6121 gagctcatga cgctgttctt gcaacctaca gcgccaaata cactcccaag ctcggttcag
     6181 tccaaattgg aacatgggac accgaggatt tgcttgaaag acagcctgtc aaattcacgc
     6241 ccgttggtct caatgaaatt ggacaagaca agcattttga ccaatgggtg ttaccaaatt
     6301 attctggtgc cttaggactc aacatgcacc tggctcctgc tgtgtcccca ctctttcctg
     6361 gagagagatt attgttcttt agatcatata tacctctaaa gggtggccat ggggacccat
     6421 tcattgattg tctagtgcca caagaatgga tacaacactt ttatcaagaa tcagccccag
     6481 cacaatcctc ggtggctcta ctgaggtatg tgaatccaga cacaggtcgc actctatttg
     6541 aggccaaatt acacaaggaa gggtttatca ccgtctctag tacggaaaat aggcctgtga
     6601 ttgtcccccc aaatggttac tttaggtttg actcttgggt taaccaattc tactcacttg
     6661 cccccatggg aactggcaat gggcgcagaa ggatgcagta atggctggag ctttcatagc
     6721 aggacttgct ggtgacattg tcactaatgg cattggttcg cttgtgaacg ctggagccaa
     6781 tgccataaac caaaaagttg attttgaaaa taacaaacag ctacaacaag cttcttttaa
     6841 tcatgacaaa gagatgctgc aagcccaaat ccaagccacc aaacagctac aggctgacat
     6901 gatttcaatc agacaagggg ttttgtccgc gggcggcttt tcccctactg atgctgcaag
     6961 gggcgcagtc aacgcaccaa tgacccaagt gttggactgg aatgggacta gacattgggc
     7021 ccctggagcc ccaagaacta ccagtttctc tggtgggttc accaactcca cccgtgccag
     7081 aacagttgag ccacccaaaa gttccccccc tgttcaaaat accttgatct ctgcttctag
     7141 acctagctct actgtctcat cttcttccac ccgttcgact gtggtcacta gttcctctac
     7201 tgccccatct gttagatctt ctgtaactag aaattcacca cgcagtgctt ctcaatctgt
     7261 ttcttctgct tcttctcgca ctggtgattg ggtacaaaat caaaatagaa tgctggagcc
     7321 atacctgagg gggtcgttgc aaacagcctt cgtgtcgccg ccctccagta aggcctctag
     7381 taatggcact gtctcaactg tgccaaaaga agttttggac tcctggacat ctgcgtttaa
     7441 cacccgcaga cagccgctct tcgctcacct ccgtcggagg ggggagtcac aagcttagtg
     7501 aaaagaatca gattttcttt ttctttcttt tcttcgttga aaatcttatg tcttttaaaa
     7561 aaaaaaaaaa aaaaaaa
//