Typing tool

Complete norovirus genomes

GU017903  GII.14
 GII.P7

Length: 7,529 | 3 CDS

ORF1: 5..5098
ORF2: 5079..6689
ORF3: 6689..7483
LOCUS       GU017903                7529 bp    RNA     linear   VRL 13-FEB-2013
DEFINITION  Norovirus Hu/GII.14/8533/Maizuru/2008/JPN, complete genome.
ACCESSION   GU017903
VERSION     GU017903.2
KEYWORDS    .
SOURCE      Norovirus Hu/GII.14/8533/Maizuru/2008/JPN
  ORGANISM  Norovirus Hu/GII.14/8533/Maizuru/2008/JPN
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7529)
  AUTHORS   Chan-It,W., Thongprachum,A., Okitsu,S., Nishimura,S., Kikuta,H.,
            Baba,T., Yamamoto,A., Sugita,K., Hashira,S., Tajima,T.,
            Mizuguchi,M. and Ushijima,H.
  TITLE     Detection and genetic characterization of norovirus infections in
            children with acute gastroenteritis in Japan, 2007-2009
  JOURNAL   Clin. Lab. 57 (3-4), 213-220 (2011)
   PUBMED   21500729
REFERENCE   2  (bases 1 to 7529)
  AUTHORS   Chanit,W.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-SEP-2009) Developmental Medical Sciences, Institute
            of International Health, The University of Tokyo, Hongo, Bunkyo,
            Tokyo 113-0033, Japan
REFERENCE   3  (bases 1 to 7529)
  AUTHORS   Chanit,W.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-FEB-2010) Developmental Medical Sciences, Institute
            of International Health, The University of Tokyo, Hongo, Bunkyo,
            Tokyo 113-0033, Japan
  REMARK    Sequence update by submitter
COMMENT     On Feb 2, 2010 this sequence version replaced GU017903.1.
FEATURES             Location/Qualifiers
     source          1..7529
                     /organism="Norovirus Hu/GII.14/8533/Maizuru/2008/JPN"
                     /mol_type="genomic RNA"
                     /isolate="Hu/GII.14/8553/Maizuru/2008/JPN"
                     /isolation_source="stool"
                     /host="Homo sapiens"
                     /db_xref="taxon:683855"
                     /country="Japan"
                     /collection_date="2008"
                     /note="genotype: GII.14"
     CDS             5..5098
                     /note="contains helicase, VPg, 3Cpro, and RdRp"
                     /codon_start=1
                     /product="polyprotein"
                     /protein_id="ACX81344.2"
                     /translation="MKMASNRAPHAFGSQNSVNDSINATPSNKEEVGAFSNIKVGFKK
                     MLGAVPKGTKAPSSGQHCPTVKIGPKTLTIPPEPPNGEDTVQFDAKSETIIGLPDLTT
                     VQNEHENTPYTVPPLSEREHRSATEPLPGTILEMWDGEFYHYSVYVSDGKALGVHKPP
                     AAISLATIELTPISLYWRPVYTPNYLVSPDTLKGLAGEKFPYTAFSNNCYNFCCWVLE
                     LNDTWLNRRCISRTTGFFKPYQSWNRKPLPTVDDGKIKRVANAILCALGSLFSKPIKD
                     LLGKLKPLNLLHLLASCDWTFAGIVETVILMAELFNIFWTPPDVSNFIASLIGDFELQ
                     GPEDLAVELVPVVMGGIGMVLGFTAEKIGRMLSSAASTLRACKDLGNYALDILKLVMK
                     WFFPKKEEKAEMETLRAIEDAVLDMEAIGNNHLTTLLKDKDSLTAFMKTLDLEEEKAR
                     KLSTKSSSPDIVGTINAILARIAAARSLLHKAKEEMFSRIRPVVVMISGRPGIGKTHM
                     ARHLAKSIANTMSGDQRVGLVPRNGVDHWDAYRGERVVLWDDYGMGSPVKDALTLQEL
                     ADTCPVTLNCDRIENKGKMFDSDVIIITTNLVNPAPLDYVNFEACSRRVDFLVYAESP
                     EIEKVKRDFPGQPDMWKDHFKPDFSHIKLTLAPQGGFDKNGNTPHGKGTMRSLTQGSL
                     TARVAGLVHERRDEFQLQGNDLQTYNFDTNRVSAFRKLAADNKYGIMETMRVGAALKN
                     VKTLEDLKFALRDVKFNECEIIYKNSKYRVSSNGKGSVSVDKIEDNASQTANEVQSAL
                     LRLRQARARYYISCFQDLVYTLIQVAGASFVVNRISKRFCWERWVKPTETQDVNESEK
                     EVAQGRWEIEPKDTEPEGKKGKNKKGRGKKHTAFSSKGLSDEEYDEFKRIREERNGKY
                     SIEEYLQDRDRYYEEVAVARATEEDFCEEEEAKIRQRIFRPTKKQRKEERGVLGLVTG
                     TDIRKRRPDDFQPKGNLWADDTRSVDYNERLDFEAPPSVWSRIVPLGTGWGFWVSSNL
                     LITTTHVLPKGVKELFGVEIKQIQVHKSGEFCRFRFPRPIRPDVTGLVLEEGAPEGTV
                     CSILIKRPTGEMIPLAVRMGTHASMKIQGRTVGGQMGMLLTGANAKNMDLGTGPGDCG
                     CPYIYKRGNDIVVAGVHTAAARGGNTVICATQGQDGEAVLEGNEDLGTYCGAPILGPG
                     KAPKLSTKTKFWRSSPDALPPGTYEPAYLGGKDPRVERGPSLQQVMRDQLRPFTEPRG
                     KPPRPAVLEEAKKTVMNVLEQTIDPAKPWSYSQACASLDKTTSSGSPHHVKKNDHWNG
                     ESFTGPLADQASKANLMYEQAKHVQPVYTAALKDELVKTDKIYKKIKKRLLWGSDLGT
                     MIRCARAFGGLMDSMKASCIALPCRVGMNMNEDGPIIFDKHSKYRYHYDADYSRWDST
                     QQRSILSAAMEVMVRFSAEPELAQVVAEDLLAPSQLDVGDFIISVQEGLPSGVPCTSQ
                     WNSIAHWILTLSAMAEVSGLSPDVVQAHSCFSFYGDDEIVSTDINLDPMKLTQKLREY
                     GLVPTRPDKTEGPLVITEDLTGLTFLRRSIARDPAGWFGKLDQDSILRQLYWTRGPNH
                     ENPYESMVPHSQRATQLMALLGEASLHGPQFYKKVSKMVINEIKSGGLEFYVPRQEAM
                     FRWMRFSDLSTWEGDRNLAPEGVNEDGVE"
     CDS             5079..6689
                     /note="ORF2"
                     /codon_start=1
                     /product="capsid protein"
                     /protein_id="ACX81345.2"
                     /translation="MKMASNDATPSDDGAAGLVPEINSEVMALEPVAGASLAAPVVGQ
                     QNIIDPWIRNNFVQAPAGEFTVSPRNSPGELLLDLELGPELNPYLAHLARMYNGHAGG
                     MEVQIVLAGNAFTAGKILFAAIPPSFPYENLSPAQLTMSPHVIVDVRQLKPVLLPMPD
                     IKNDFNHYNQKNNTKLRLVAMLYTPLRANNSGDDVCTESCRVLTRPSPDFQFTFLVPP
                     TVESKTKNFTLPVLRVSEMTNSRFPVVLDQMYTSRNENIIVQPQNGRCTTDGELLGTT
                     ILQSVSICNFKGTMQAKLNEEPRYQLQLTNLDGSPIDPTDDMPAPLGTPDFQAMLYGV
                     ASQRSSIDNATRAHDAQIDTAGDTFAPKIGQVRFKSSSNDFDLHDPTKFTPIGVNVDD
                     QHPFRQWSLPNYGGHLALNNHLAPAVTPLFPGEQILFFRSYIPSAGGHTDGAMDCLLP
                     QEWVEHFYQEAAPSQSDIALVRFINPDTGRVLFEAKLHKQGFLTIAASGDHPIVMPTN
                     GYFRFEAWVNPFYTLAPVGTGSGRRRIQ"
     CDS             6689..7483
                     /note="ORF3"
                     /codon_start=1
                     /product="minor structural protein"
                     /protein_id="ADC34935.1"
                     /translation="MAGAFLAGLAGDVVTSSLGSLVGAGANAINQKVEYDFNRQLQEA
                     SFRHDKDMLKAQVAATAGLQQAMIDIKREALTAGGFSPADAARGAVRAPMTQILDWNG
                     SRYWAPNSMKTTGYSGTFASQGIKSSPHLSNQIPSVVKSTKPLPSISSSSSVYSSPST
                     APSQSTQSTTLSAGTGSSRSNTVSTKTSTLSRTSDWVRGQNEMLGPFMSGALQTAYVT
                     PPSSRASSQGTVSTVPKAVLDSWTPMFNTHRQPLFAHLRRRGESQI"
ORIGIN      
        1 gtgaatgaag atggcgtcta accgcgctcc gcatgccttt ggcagtcaaa actctgtcaa
       61 tgacagtatc aacgccaccc cttccaataa ggaagaggtt ggtgcatttt ccaacatcaa
      121 agttggattt aagaaaatgc tgggtgctgt acccaagggc actaaagcac ccagcagtgg
      181 tcaacattgt cccacagtta agatcgggcc caaaacatta acaattcccc ctgagccccc
      241 aaatggtgaa gacactgtgc agtttgatgc aaagtcggaa actataattg ggctgccgga
      301 cttgacaacg gtgcaaaacg aacatgaaaa caccccatac accgtccccc cattaagtga
      361 gagggagcac agatcggcca ctgaaccact tcctggcaca atattggaga tgtgggatgg
      421 tgaattttac cactactccg tgtatgtcag cgatggcaaa gctctggggg tccacaaacc
      481 accggctgct ataagcctcg cgacgataga gctcaccccc atatctctct actggagacc
      541 cgtttacacc cccaactatt tggtctcccc agacacattg aaaggcctcg ctggtgagaa
      601 gttcccctac acggccttta gtaacaattg ttataacttt tgttgttggg tgcttgagct
      661 caacgacacg tggctcaaca gaagatgcat ttccagaacc accggcttct tcaaacctta
      721 tcagtcttgg aacaggaagc ccctcccaac cgttgatgat ggaaagatca aaagggtggc
      781 caacgcgatc ctctgtgcac tcggctcgct gttctcaaag ccaatcaaag atttgttagg
      841 caaacttaag ccattgaacc tgctacactt gcttgcgtca tgcgattgga cgtttgcagg
      901 tatagtggag acagtcatct taatggcaga acttttcaat atcttctgga ccccgccaga
      961 tgtctctaat tttatagcct ccctgatagg tgattttgaa ttacaagggc ctgaggacct
     1021 ggctgtggaa ctcgttcctg tggttatggg tggcatagga atggttctcg gcttcaccgc
     1081 tgagaagata ggccgtatgc tgtcatccgc cgcatcaaca ctgcgggcat gcaaagacct
     1141 agggaactat gcccttgaca ttctcaaatt ggtcatgaag tggttcttcc caaagaagga
     1201 agagaaagct gagatggaaa ccttgagggc gatcgaggat gccgtactag atatggaagc
     1261 tatagggaat aaccatctca cgaccctcct caaggacaaa gacagcctca cggcttttat
     1321 gaagaccctg gacctggaag aggaaaaagc aagaaaactg tccactaagt catcttcacc
     1381 ggacatcgtc ggcaccatta atgccatact agctaggatt gctgctgcca gatcccttct
     1441 acataaggcc aaagaagaga tgtttagtag gatcagacca gtggtcgtta tgatatcagg
     1501 cagacctggc attggcaaaa cccacatggc aagacatttg gctaagagca tcgccaacac
     1561 catgagtggc gaccagagag tcgggctcgt cccacgcaac ggtgtcgacc actgggatgc
     1621 ctacagagga gagagggtgg tcttgtggga cgactacggt atggggagcc ctgttaaaga
     1681 tgccttaaca ctacaggagt tggccgacac ctgtccagtc actttaaatt gtgataggat
     1741 tgagaacaag gggaagatgt tcgacagtga tgtcatcata atcacaacca acctggtcaa
     1801 ccccgcgccc ctcgattatg tgaacttcga ggcgtgttcc aggagagttg acttcttggt
     1861 ctatgcagag tcaccagaga ttgaaaaggt caagagggac ttccctggcc aacctgacat
     1921 gtggaaagac cattttaagc cagacttttc tcacatcaag ctaactctag ccccccaggg
     1981 cgggtttgac aagaatggta acactccaca cggtaaggga accatgcggt ccctgaccca
     2041 ggggtccctg actgcaagag ttgcgggcct tgtccatgag aggagagatg agttccaact
     2101 ccaaggaaac gacctccaaa catacaattt tgacaccaac agagtctccg cattcagaaa
     2161 actggctgca gataacaagt atggtatcat ggaaacgatg agagtaggtg cggcactcaa
     2221 aaatgtaaag accttggaag atctaaaatt tgcattaagg gatgtgaaat tcaatgagtg
     2281 tgaaataatt tacaagaact ctaagtatcg agtctcttcc aacggtaaag gctcagtttc
     2341 tgttgacaaa attgaggaca atgcatccca gaccgcaaac gaggtacaat cagcacttct
     2401 caggctcaga caagcgaggg ccagatatta catcagctgc ttccaagacc tcgtctacac
     2461 tctcatacag gttgccggag catcattcgt tgtcaacaga atttccaaaa ggttctgctg
     2521 ggaaaggtgg gtcaaaccaa ccgagaccca ggatgtgaat gagtccgaga aggaagtggc
     2581 tcaaggtaga tgggaaattg agcccaagga cacagaacca gaaggcaaga agggtaaaaa
     2641 caagaaagga aggggcaaga aacacacagc tttctctagc aaaggcctga gtgatgaaga
     2701 gtatgacgag ttcaagagaa tcagggaaga aaggaatgga aagtactcca ttgaggaata
     2761 cctgcaagac cgggaccgct attatgaaga agtggcggtt gcccgggcaa cagaggagga
     2821 cttctgtgaa gaggaagagg ccaaaataag acaaagaatt ttccgcccga caaagaaaca
     2881 aaggaaggag gaaaggggtg tacttggctt agtcaccggc acagacatca gaaagaggag
     2941 accagacgat tttcaaccaa aaggcaatct gtgggcagat gacaccagga gtgtggacta
     3001 caatgagaga cttgattttg aagcgccccc aagtgtctgg tcaagaatag tcccattagg
     3061 cactggttgg ggtttctggg tttcatccaa ccttctaatc acaacaacac acgtcctgcc
     3121 taaaggggtt aaggaactct ttggagttga aatcaaacag atccaagttc acaagtctgg
     3181 agagttttgc aggtttagat tcccaagacc aatcaggcca gatgtcacag ggctcgtgtt
     3241 ggaggaaggc gccccagaag gcactgtctg ttctatactc ataaagagac ctacaggtga
     3301 gatgatcccc ttggcagtga ggatgggcac acacgcatcc atgaaaatac aaggcaggac
     3361 cgttggtggc cagatgggaa tgcttctaac aggagcaaat gcgaagaaca tggatcttgg
     3421 caccggccct ggtgactgcg gttgtcccta catctacaaa cgcggcaacg acatagttgt
     3481 cgcgggtgtc cacaccgcag cagcccgggg aggtaacact gtcatatgtg ccactcaagg
     3541 gcaagatggg gaagcagtcc ttgagggaaa tgaggacctc ggtacctact gtggcgcccc
     3601 aattctgggc cctggtaagg cacctaaact cagcacgaag accaagtttt ggcgctcatc
     3661 accagatgcc ttgccacctg gcacatatga acctgcttac ctgggaggca aagaccccag
     3721 agtggaaaga ggaccttccc tgcagcaagt catgagagac cagttgagac ccttcacaga
     3781 acccagggga aaaccgccta gacctgcagt cttagaagaa gccaagaaga cagtgatgaa
     3841 tgttttagaa caaaccattg accctgcaaa accgtggtcc tactcgcaag catgtgcctc
     3901 actggacaaa accacttcta gtggtagccc ccatcatgta aagaaaaatg accactggaa
     3961 tggggagtcc ttcactggtc cccttgcaga tcaggcatcc aaagccaacc tcatgtatga
     4021 acaggctaaa catgtgcagc ccgtgtacac ggccgcgctc aaagatgagc ttgttaagac
     4081 tgacaagatc tacaaaaaga taaagaagag gctcctatgg ggatcggacc ttggaacaat
     4141 gatcaggtgc gccagggctt ttggtggtct catggacagc atgaaggcaa gctgtatagc
     4201 tcttccatgc agggtaggaa tgaacatgaa tgaagatggc cctatcatat ttgacaaaca
     4261 ttctaagtat aggtaccact atgatgctga ctattctagg tgggactcaa cccagcaaag
     4321 gagcattctt tctgccgcta tggaagtgat ggtgcgattt tctgctgaac cagaattggc
     4381 acaagtggtt gcagaggacc ttttggcgcc tagtcagctt gatgttggtg attttatcat
     4441 ctcagttcag gagggcctgc catcaggagt cccatgtaca tcacaatgga actcaatagc
     4501 acactggatc ctaactttga gtgcgatggc agaagtgtca ggtctctcac cagatgttgt
     4561 ccaagctcac tcctgctttt cattttatgg ggacgatgag atcgtcagca ctgacatcaa
     4621 ccttgacccc atgaagttga cacagaaact cagggagtac ggcctggtcc ccacccgacc
     4681 tgataaaact gaaggtcccc tcgtcataac tgaagacctc accggcctga cgttccttcg
     4741 taggtcgatt gcacgggacc cagctggatg gtttggaaaa ttggaccaag attcaatcct
     4801 caggcaacta tactggacaa gggggcctaa ccatgagaac ccgtacgaga gcatggtccc
     4861 tcattcccag cgggccacac agcttatggc tcttcttggt gaggcttcac tgcatggtcc
     4921 ccaattttac aagaaagtca gcaaaatggt tattaatgag attaagagtg gtggtctgga
     4981 attttatgtg cccagacagg aggccatgtt caggtggatg agattctctg acctcagcac
     5041 atgggagggc gatcgcaatc ttgctcccga aggtgtgaat gaagatggcg tcgaatgacg
     5101 ctactccatc tgatgatggt gcagccggcc tcgtaccaga gatcaacagt gaggttatgg
     5161 ctcttgaacc cgtcgctggg gcctcccttg cagcccccgt agtcggccaa cagaatataa
     5221 ttgatccctg gattagaaat aattttgtac aagcccctgc tggtgaattc acagtttccc
     5281 ctagaaactc tcctggagaa cttctacttg atttggaatt gggtcctgaa cttaatccct
     5341 atcttgcaca tttggccagg atgtacaatg ggcatgcagg aggaatggaa gtgcagatag
     5401 tactggctgg gaatgcgttc acagctggta agatcctatt tgctgccatc ccgcctagct
     5461 tcccctatga aaatttgtca cccgctcaat tgactatgag cccccatgtg atagtggatg
     5521 tgaggcaatt aaaaccagtg cttctgccaa tgccagatat aaaaaatgat ttcaaccact
     5581 ataaccagaa aaataatacc aaacttaggc ttgtagctat gctttatacc cctctgaggg
     5641 ctaacaactc aggtgatgac gtgtgcacgg agtcttgccg cgttttaaca cgtccttctc
     5701 cagatttcca gttcaccttt ctggtcccac ctacagttga gtctaaaact aagaatttca
     5761 cccttcccgt tcttagagtc tcagagatga caaactcaag gttccccgtt gttttagacc
     5821 aaatgtatac aagcaggaat gaaaacatca ttgtccaacc ccaaaacggc aggtgcacga
     5881 ctgacggtga gctgcttggc actaccatct tgcagtctgt gtctatttgc aactttaaag
     5941 gaacaatgca ggcaaagctg aatgaagaac cacgatacca actacaactc accaacttgg
     6001 atgggtcacc catagatcca acagatgata tgcctgcccc tcttggcaca ccagacttcc
     6061 aggccatgtt atatggcgtt gcaagccaac gctcttccat agacaatgcc accagggcac
     6121 atgatgcaca gattgacact gcgggtgaca cattcgcccc gaaaattggc caggttcgtt
     6181 ttaaatcaag ctctaatgat tttgacctac atgaccctac aaaattcaca cctattggtg
     6241 tcaatgtgga tgatcagcac ccttttagac agtggtccct gccaaactat ggtggtcacc
     6301 ttgccctgaa caaccattta gcccccgctg tgacaccact ctttcctggc gagcagattt
     6361 tgttcttcag gtcatacatt ccgagcgccg gaggccacac agacggtgct atggactgct
     6421 tgctgcccca agagtgggta gagcacttct accaggaagc ggctccttcc caatctgaca
     6481 ttgcactggt aaggttcatc aaccctgata caggaagagt gctctttgaa gctaaattgc
     6541 ataaacaagg tttcctcaca attgcagcat ctggagatca ccctattgtg atgcccacta
     6601 atggttactt taggtttgaa gcttgggtta accctttcta cactctcgcc cccgtgggaa
     6661 ctgggtctgg gcgcaggagg attcaataat ggctggagct ttccttgcag gcttggcagg
     6721 tgacgttgtg acttccagct tgggctcact tgtgggcgct ggagccaacg ccatcaacca
     6781 gaaagtggag tatgacttca acagacagct ccaggaggca tcttttagac atgataagga
     6841 tatgctcaaa gcccaggttg cagcaacagc aggccttcaa caggccatga tagacatcaa
     6901 gcgggaggca ttgaccgcag gcggcttttc ccccgctgat gctgcaaggg gtgcagttag
     6961 agcgcctatg acacagattc ttgactggaa tggttctagg tattgggccc ctaactccat
     7021 gaagacaact ggctattcag gtacatttgc ttcccaaggc attaaaagtt ccccccacct
     7081 gtctaatcaa attccaagtg ttgttaaatc taccaaacct ttaccatcta tatctagttc
     7141 ctctagtgta tatagttctc cttctactgc cccttcacaa tcaacacaat caacaacgct
     7201 gtctgcagga acagggtcct ccagatctaa caccgtgtcc acaaagacct ctacactgtc
     7261 gaggacaagt gactgggtta gaggtcaaaa tgagatgctt ggcccgttca tgagtggtgc
     7321 actccaaact gcttatgtca caccaccatc gagcagggcc tcatcacaag ggacggtctc
     7381 gaccgtaccc aaggctgttt tggactcctg gactcccatg ttcaacaccc acaggcagcc
     7441 tctcttcgcc cacttgcgta ggcgagggga gtcacagatt tagtgaaaag gatgattagg
     7501 gtttcttcct ttccccttct tattctttt
//