Typing tool

Complete norovirus genomes

GQ845369  GII.4 Osaka
 GII.P31

Length: 7,560 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       GQ845369                7560 bp    RNA     linear   VRL 06-FEB-2012
DEFINITION  Norovirus Hu/GII.4/Armidale/NSW390I/2008/AU, complete genome.
ACCESSION   GQ845369
VERSION     GQ845369.3
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Armidale/NSW390I/2008/AU
  ORGANISM  Norovirus Hu/GII.4/Armidale/NSW390I/2008/AU
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7560)
  AUTHORS   Eden,J.S., Bull,R.A., Tu,E., McIver,C.J., Lyon,M.J., Marshall,J.A.,
            Smith,D.W., Musto,J., Rawlinson,W.D. and White,P.A.
  TITLE     Norovirus GII.4 variant 2006b caused epidemics of acute
            gastroenteritis in Australia during 2007 and 2008
  JOURNAL   J. Clin. Virol. 49 (4), 265-271 (2010)
   PUBMED   20888289
REFERENCE   2  (bases 1 to 7560)
  AUTHORS   Eden,J.-S., Bull,R.A. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-2009) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
REFERENCE   3  (bases 1 to 7560)
  AUTHORS   Eden,J.-S., Bull,R.A. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JUL-2010) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
  REMARK    Sequence update by submitter
REFERENCE   4  (bases 1 to 7560)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
  REMARK    Sequence update by submitter
COMMENT     On Feb 6, 2012 this sequence version replaced GQ845369.2.
FEATURES             Location/Qualifiers
     source          1..7560
                     /organism="Norovirus Hu/GII.4/Armidale/NSW390I/2008/AU"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/NSW390I/2008/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:676540"
                     /country="Australia"
                     /collection_date="2008"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ADK12920.2"
                     /translation="MKMASNDASAAAAANSNNDIAKSSSDGMLSNMAVTFKRALGARP
                     KQPPPKEIPPRPPRPPTPELVKKIPPPPPNGEDELVVSYSAKDGVSGLPELTTVKQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTIIEMWDGEIYHYGLYVERGLILGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLRRLHGESFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LKPLNILNILATCDWTFAGIVESLILMAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPIVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINSLLARIAAARSLVHRAKEELSSRPRPVVVMISGKPGIGKTHLAREL
                     AKKIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTLTTFNFDRNKILAFRQLAAENKYGLMDTMRVGKQLRDVKTM
                     PDLKQALKNVSIKKCQIVYGGSTYTLEADGKGSVKVDKVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRITKRMNIQNLWSKPQVEDTEEAASKDGC
                     SRPKDDEEFVVSSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLNFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGTKEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVATLLIKRPTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPRPSVLEAAKKTIINVLEQTIDPPQKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRDVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFQISISEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTDLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSIVNEDGVE"
     CDS             5085..6707
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ACX31885.1"
                     /translation="MKMASNDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLERLYTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSAVNICTFRGDVTHIAGSRNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTRSDGSTRGHKATVLTGSADFAPKLGRVQFATDTDNDFESGQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPNYSGRTGHNVHLAPAVAPTYPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="AEZ56472.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQPSGALSGRINPRTPTPARGSSSTSS
                     SASTATSVYSNQTVSTRLGSTAGSGTNVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
     3'UTR           7514..7560
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gctgccaaca gcaacaacga
       61 catcgcaaaa tcttcaagtg acggtatgct atctaacatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agccgccccc gaaggaaata ccacccagac ccccacgacc
      181 acccacacca gaattggtca aaaagatccc tcctccccca cccaacgggg aggatgaact
      241 agtggtttcc tacagcgcca aagatggcgt ttccggcctg cctgagctca ccactgtcaa
      301 acaaccggaa gaaaccaaca cggcgttcag tgttccccca ctcaaccaga gggagaatag
      361 ggacgccaag gaaccactaa ctggaacaat tattgaaatg tgggatggag aaatatacca
      421 ctacggcctg tatgtggaac gaggtcttat acttggtgtg cacaagccac cggcagccat
      481 cagccttgcc aaggtcgagc taacaccact ctctttgttc tggaggcctg tgtatacccc
      541 ccagtatctc atctctccag acactcttag gagactgcat ggagagtcat tcccctacac
      601 tgcatttgac aacaattgct acgccttctg ttgttgggtg ttagacctaa acgactcatg
      661 gctaagcagg agaatgattc agagaacaac aggtttcttc aggccatacc aggattggaa
      721 caggaaaccc cttcccacta tggatgattc caaattaaag aaggtggcta acatattctt
      781 gtgcactttg tcttcactat tcaccagacc cattaaggac ataataggga agttgaaacc
      841 tcttaacatt ctcaacattc tggctacgtg tgattggacc ttcgcaggca tagtggagtc
      901 cctgatactc atggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gatcgcccct ttactaggtg attacgagct gcaaggacct gaggaccttg cagtagaact
     1021 agtcccaata gtgatggggg ggataggttt ggtgctagga tttaccaaag agaaaattgg
     1081 aaagatgttg tcatctgctg catccacttt gagagcctgt aaagaccttg gtgcatacgg
     1141 actggaaatt ttgaaattgg tcatgaaatg gttcttccca aagaaagagg aagcaaacga
     1201 attggctatg gtgagatcca tcgaggatgc ggtgctggac ctcgaggcaa ttgaaaacaa
     1261 ccacatgacc accctgctca aagacaaaga cagcttggca acctacatga gaacccttga
     1321 ccttgaggag gagaaagcca gaaaactctc aaccaaatct gcttcacccg atattgtggg
     1381 cacaatcaac tctcttctgg caagaatcgc tgctgcacgc tccctagtgc atcgggcgaa
     1441 agaagagctc tccagcaggc cgagacctgt tgttgtgatg atatcgggaa aaccagggat
     1501 agggaaaact caccttgcca gggagctggc caagaagatc gcagcctccc tcacagggga
     1561 ccagcgcgtg ggtctcatcc cgcgcaatgg tgtcgaccat tgggacgcgt acaagggaga
     1621 aagggttgtc ctgtgggacg actatggaat gagcaacccc attcatgatg ccctcaggtt
     1681 gcaggaactt gctgacactt gccccctcac gctaaattgt gacaggattg agaacaaagg
     1741 gaaagtcttt gacagtgatg ccataattat caccaccaat ctggccaacc cagcaccact
     1801 ggattatgtc aactttgaag cgtgctcgag gcgcattgac ttcctcgtgt acgcagaggc
     1861 tcctgaggtg gaaaaagcaa agcgcgactt cccaggccaa cctgacatgt ggaagaacgc
     1921 tttcagtcct gacttctcgc acataaaact gtcattggct ccacagggtg gttttgataa
     1981 gaacggcaac accccacatg gaaaaggcgt catgaaaacc ctcactaccg gttccctcat
     2041 cgcccgagca tcagggttac tccatgagag gctagatgaa tatgaattgc aaggcccaac
     2101 tctcaccact ttcaactttg accgcaacaa gatccttgct ttcagacagc ttgctgctga
     2161 aaacaagtat gggctcatgg acacaatgag agttggaaaa cagctcaggg atgtcaagac
     2221 catgccagac ctcaaacaag cactcaagaa tgtctcgatc aaaaagtgcc agatagtgta
     2281 cggtggtagc acctacacac ttgaggccga tggcaagggc agtgtgaaag ttgacaaagt
     2341 gcaaagtgcc actgtgcaaa ccaacaacga actagccggt gccctacacc acctaaggtg
     2401 cgccagaatt agatactatg tcaagtgtgt ccaggaggca ctgtactcca tcatccaaat
     2461 tgctggggct gcatttgtca ccacgcgcat tactaagcgc atgaacatac agaacctctg
     2521 gtccaagcca caggtggagg acacagaaga ggcggccagc aaagatggtt gctcaagacc
     2581 caaagatgat gaagagtttg tcgtttcatc cgacgacatc aaaactgagg gcaagaaagg
     2641 gaaaaacaag actggccgtg gtaagaagca cacagccttc tcaagcaaag ggctcagtga
     2701 tgaggagtac gatgagtaca agagaatcag ggaagagagg aatggcaagt actccataga
     2761 agagtacctt caggacagag acaagtatta tgaggaggtg gccattgcca gggcaaccga
     2821 agaggacttc tgtgaagaag aagaggccaa aatccggcag agaattttta gaccaacaag
     2881 gaaacaacgc aaagaagaga gggcctctct cggcttggtc acaggctctg aaatcaggaa
     2941 gagaaaccca gaagacttca aacccaaggg aaaactgtgg gccgacgatg acagaagtgt
     3001 tgactacaat gagaaactca actttgaggc cccaccaagc atctggtcgc ggatagtcaa
     3061 ctttggttca ggttggggct tctgggtctc ccccagtctg tttataacat caacccatgt
     3121 cataccccaa ggtacaaaag agttcttcgg agtccccatc aaacaaatcc agatacacaa
     3181 atcaggtgaa ttctgccggt taagattccc aaagccaatc agaactgatg tgacgggcat
     3241 gattctagaa gaaggtgcgc ccgaaggaac cgtggccaca ctactcatca agagaccaac
     3301 tggggaactc atgcctctgg cagctagaat gggaacccat gcaaccatga agattcaagg
     3361 gcgcacagtt ggaggacaaa tgggcatgct cctgacaggg tccaacgcca agagtatgga
     3421 cctaggcaca acaccgggtg actgcggctg tccctacatc tacaagaggg ggaatgacta
     3481 cgtggtcata ggagtccata cggccgctgc ccgtggagga aacactgtca tatgtgccac
     3541 ccaggggagt gaaggggaag ccacacttga aggtggtgac aataaaggaa catactgtgg
     3601 tgcaccaatc ttgggcccag ggagtgcccc aaaactcagt actaagacta agttttggag
     3661 atcatccaca acaccactcc cacctggcac ctacgaacca gcctacctcg gtggcaagga
     3721 ccccagagtc aaaggtggcc cttcattgca acaagttatg agggaccagc taaaaccatt
     3781 cacagaaccc agaggtaaac caccaagacc aagtgtgttg gaagctgcca agaaaaccat
     3841 catcaatgtt cttgagcaaa caattgaccc accccaaaaa tggtcattcg cgcaagcttg
     3901 cgcatctctt gacaaaacca cttccagcgg ccacccgcac catatgcgga agaatgactg
     3961 ttggaacggg gagtcattca caggaaaatt agcagatcag gcctccaagg ccaatctaat
     4021 gtttgaagag gggaagaaca tgactccagt ctacacaggt gcacttaagg atgaattggt
     4081 aaagactgac aaaatttatg gtaagatcaa gaagaggctt ctgtggggct cagacctggc
     4141 gaccatgata cggtgcgccc gagcttttgg aggccttatg gatgaactca aggcacattg
     4201 tgtcaccctc cctgtcagag ttggtatgaa catgaatgag gatggcccca tcatctttga
     4261 gaaacactcc agatataaat atcattatga tgctgattat tcccggtggg actcaacaca
     4321 acaaagggat gtgctagcag cagccctaga aatcatggtt aaattctctc cagaaccaca
     4381 cctggctcaa atagttgcag aagacctact ttcccctagt gtaatggatg tgggtgactt
     4441 tcaaatatca ataagtgagg gactcccctc tggggtgcct tgcacctccc aatggaattc
     4501 catcgcccat tggctcctca ctctttgtgc actctctgaa gtcacggacc tgtcccctga
     4561 catcattcag gccaattccc tcttctcctt ctatggtgat gatgagattg tgagtacaga
     4621 cataaagttg gatccagaga aactgacggc aaaactcaag gagtacgggc tgaaaccaac
     4681 ccgccccgac aaaactgaag gaccccttgt tatctctgaa gatctggatg gcctgacatt
     4741 cctgcggagg actgtgaccc gtgacccagc tggttggttt ggaaaattgg aacaaagctc
     4801 aatcctcagg caaatgtact ggaccagggg ccccaaccat gaagatccat ctgaaacaat
     4861 gataccacac tcccaaagac ccatacaatt gatgtctctg ctgggcgagg ctgcgctcca
     4921 cggcccggca ttctatagta aaattagtaa gttagtcatt gcagagttga aggaaggtgg
     4981 catggatttt tacgtgccca gacaagagcc aatgttcaga tggatgagat tctcagatct
     5041 aagcacgtgg gagggcgatc gcaatctggc tcccagtatt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gtaggtgccg ctattgcggc gcctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagttcacag
     5281 tgtcccctag aaatgctcca ggtgagatac tatggagtgc gcccttgggc cctgatttga
     5341 acccttacct ttctcatctg gccagaatgt ataatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccggaaaaat catatttgca gcagttccac
     5461 ctaactttcc aactgaaggc ttgagcccca gccaggttac tatgttcccc catataatag
     5521 tagatgttag gcaattggaa cctgtgttaa tccccttacc tgatgttagg aataacttct
     5581 atcactacaa ccaatcaaat gaccctacca ttaaattgat agcaatgctg tacacaccac
     5641 ttagggctaa taatgctggg gatgatgtct tcacagtctc ttgtcgagtc ctcacgagac
     5701 catcccctga ctttgatttc atatttctgg taccaccaac agttgaatca agaaccaaac
     5761 catttaccgt tccaatctta actgttgagg aaatgaccaa ttcaagattc cccattcctt
     5821 tggaaaggtt gtacacgggt cccagcagtg cttttgttgt ccagccacaa aacggcaggt
     5881 gcacgactga tggcgtgctc ttaggcacca cccagctgtc tgctgtcaac atctgcacct
     5941 ttagagggga tgtcacccac attgcaggct ctcgcaatta tacaatgaat ttggcctctc
     6001 aaaattggaa caactatgat ccaacagaag aaatcccagc ccccctgggc accccagatt
     6061 tcgtgggaaa gatccaaggc atgctcaccc aaaccacaag aagtgatggc tcgactcgcg
     6121 gccacaaggc cacagtgctc actgggagtg ccgacttcgc cccaaaattg ggcagagtcc
     6181 aattcgccac tgacacagac aacgatttcg aatctggcca aaacacgaaa tttaccccag
     6241 ttggcgtcat ccaggatggt tccactaccc accgaaatga acctcaacaa tgggtactcc
     6301 caaattactc aggtagaact ggtcataatg tgcatctagc ccctgctgtt gcccccactt
     6361 acccgggtga gcaactcctt tttttcaggt ccactatgcc cggatgtagc gggtacccca
     6421 acatggatct agattgtttg ctcccccagg agtgggtgca gcacttctac caagaagcag
     6481 ctccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttc
     6541 tctttgagtg caagctccat aaatcaggat atgtcacagt ggctcacact ggtcagcatg
     6601 atttggttat tccccccaat ggttatttta gatttgattc ctgggttaat caattctaca
     6661 cacttgcccc catgggaaat ggaacggggc gtagacgtgc tttataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctggactt ggttccctaa tcaatgctgg
     6781 ggctggggct atcaaccaaa agattgattt tgaaaataat agaaaattgc agcaagcttc
     6841 cttccagttt agcagtaatc tacaacaggc ttcttttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacta aaaagttgca acaggaaatg atgaaagtca aacaggcaat
     6961 gctcttagaa ggtggattct ctgaaacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaggct ttggactgga gcggaacaag gtactgggcc cctgatgcta ggactacaac
     7081 atacaatgca ggccgctttt ccacccctca accttcgggg gcattgtcag gaagaattaa
     7141 tcccaggact cccacccccg ctcggggctc ctctagtaca tcttctagtg cttctactgc
     7201 tacttctgta tattcaaatc aaactgtttc aacgagactt ggttctacag ctggttctgg
     7261 caccaatgtc tcgagtctcc cgtcaactgc aaggactagg agttgggttg aggatcaaaa
     7321 cagaaatctg tcacctttca tgaggggggc tcacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta ggcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt ctttttcttt agtgtctttt
//