Typing tool

Complete norovirus genomes

GQ845368  GII.4 Sydney
 GII.P12

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       GQ845368                7559 bp    RNA     linear   VRL 06-FEB-2012
DEFINITION  Norovirus Hu/GII.4/Sutherland/NSW505G/2007/AUS, complete genome.
ACCESSION   GQ845368
VERSION     GQ845368.2
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Sutherland/NSW505G/2007/AUS
  ORGANISM  Norovirus Hu/GII.4/Sutherland/NSW505G/2007/AUS
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7559)
  AUTHORS   Eden,J.S., Bull,R.A., Tu,E., McIver,C.J., Lyon,M.J., Marshall,J.A.,
            Smith,D.W., Musto,J., Rawlinson,W.D. and White,P.A.
  TITLE     Norovirus GII.4 variant 2006b caused epidemics of acute
            gastroenteritis in Australia during 2007 and 2008
  JOURNAL   J. Clin. Virol. 49 (4), 265-271 (2010)
   PUBMED   20888289
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Eden,J.-S., Bull,R.A. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-2009) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
REFERENCE   3  (bases 1 to 7559)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
  REMARK    Sequence update by submitter
COMMENT     On Feb 6, 2012 this sequence version replaced GQ845368.1.
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus Hu/GII.4/Sutherland/NSW505G/2007/AUS"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/NSW505G/2007/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:676544"
                     /country="Australia"
                     /collection_date="2007"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ACX31890.2"
                     /translation="MKMASNDASAAAVANSNNDTTKSSSDGVLSSMAVTFKRALGARS
                     KQPPPRDIPQKPPRPPTPELVKKIPPPPPNGEDELVVSYSVKDGVSGLPDLTTVRQPE
                     EDNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKRLHGETFPYTDFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     VRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGPED
                     LAVELVPVVMGGIGLVLGFTKEKVGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEESNELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRIRPVVVMISGKPGIGKTHLAREL
                     AKKIATSLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDAIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSPDFSHIKLSLAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEYELQGPTPTTFNFDRNKVLAFRQLAAENKYGLMDTMKIGKQLKDVKTL
                     PELKQALRNTSIKKCQIVYGGSTYTLESDGKGNVKVDRVQSATVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIAKRMNIQNLWSKPQVEDTEDTANKDGC
                     PKPKDDEEFVVSSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLDFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAQEFFGVPIKQIQIHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGNAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTVINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPVRVGMNMNEDGPIIFEKHSRYKYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQIVAEDLLSPSVMDVGDFKISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHDDPSESMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ACX31891.1"
                     /translation="MKMASSDASPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNIIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLSRMYNGYAGG
                     FEVQVILAGNAFTAGKVIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQTNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLERLYTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSAVNICTFRGDVTHITGSRNYTMNLASQNWNNYDPTEEIPAPLGTPDFVGKIQGML
                     TQTTRGDGSTRGHKATVYTGSADFAPKLGRVQFATDTDNDFESNQNTKFTPVGVIQDG
                     NTTHQNEPQQWVLPGYSGRDGHNVHLAPAVAPTYPGEQLLFFRSTMPGCSGYPNMNLD
                     CLLPQEWVQHFYQEAAPAQSEVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGAGRRRAL"
     CDS             6707..7513
                     /note="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="AEZ56471.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATQKLQQGLMKVKQEMLLEGGFFETDAARGAIN
                     APMTKALDWSGTRYWAPDARITTYNAGRFSTPQPSGALPGRTNLRATVPARGSSSAFP
                     NTSPVTSVYSNQTVSTRLGSSAGSGTSVSSLPSTARTRGWVEDQNRNLSPFMRGALNT
                     SFVTPPSSRSSSQSTVSTVPKEILDSWTGAFNTRRQPLFAHVRKRGESRV"
     3'UTR           7514..7559
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 cacaacaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggtctaaac aacctccccc gagggacata ccacaaaaac ccccacgacc
      181 gcccacccca gaactggtca aaaagatccc ccctcccccg cccaacgggg aggatgagct
      241 agtggtttct tacagtgtta aagatggcgt ctctggtctg cccgacctca ccactgtcag
      301 gcaacctgaa gaagacaata ctgccttcag tgttccccca ctcaaccaga gggagaatag
      361 ggacgccaag gagccactaa ctggaacaat tctggaaatg tgggatggag aaatctacca
      421 ctacggtctt tatgtggagc gaggtcttgt acttggtgtg cacaaaccac cagctgccat
      481 tagcctcgcc aaggttgaac tgacaccact ctctctgttc tggagacctg tgtacacccc
      541 ccagtatctc atctctccag acactctcaa aaggctgcac ggggaaacat tcccttacac
      601 agattttgac aacaactgct atgccttctg ttgctgggtc ttggacctaa acgactcttg
      661 gttgagtagg agaatgatcc agagaacaac tggtttcttc agaccctatc aagattggaa
      721 taggaaaccc ctccccacca tggatgattc taagttaaag aaggtggcta acatattcct
      781 atgtgctcta tcctcactgt ttaccagacc cattaaagac atcataggga aggtgagacc
      841 tctcaacatt cttaacatcc tggcctcatg tgactggact tttgcaggca tagtggaatc
      901 cttgatactc ttggcagagc tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttgctaggtg actacgagct gcaggggcct gaggaccttg cagtggaact
     1021 cgtaccagta gtgatggggg gaattggttt ggtgctagga tttaccaaag agaaagttgg
     1081 gaagatgttg tcatctgctg catccaccct aagagcttgc aaagaccttg gtgcgtacgg
     1141 actggagatc cttaaattgg tcatgaaatg gttcttccca aagaaagagg aatctaatga
     1201 attggctatg gtgaggtcca ttgaggacgc ggtgctagac ctcgaggcaa ttgagaacaa
     1261 ccatatgacc accctgctca aagataaaga cagcctggca acctacatga gaaccctaga
     1321 ccttgaagag gagaaagcta gaaaactctc aaccaagtct gcctcacctg acatcgtggg
     1381 tacaatcaac gctcttctgg cgagaattgc cgctgcacgc tccctggtgc accgagcgaa
     1441 ggaggagctt tccagcagaa taagacctgt tgttgtgatg atatcaggca aaccaggaat
     1501 agggaagacc caccttgcca gggaactggc taagaaaatc gcaacctccc tcacagggga
     1561 ccagcgtgtg ggtctcatcc cacgtaatgg tgtcgaccac tgggacgcat acaaggggga
     1621 gagggtcgtt ctgtgggacg actacgggat gagcaaccct atccatgatg ctctcaggtt
     1681 acaagagctc gctgacactt gccccctcac gctgaactgc gataggattg aaaacaaagg
     1741 aaaggtcttt gacagtgatg ccataatcat caccaccaat ttggccaacc cagcaccgct
     1801 ggattatgtc aactttgaag cttgctcgag gcgcattgac ttcctcgttt atgcagaagc
     1861 ccctgaagtc gagaaggcga aacgtgactt cccaggtcaa cccgacatgt ggaagaacgc
     1921 tttcagccct gatttctcgc acataaaact gtcactggct ccacaaggcg gcttcgacaa
     1981 gaatgggaac accccacatg ggaagggcgt catgaagact ctcaccactg gttcgctcat
     2041 tgctcgggca tcagggctac tccatgagag gctggatgag tacgagctac aaggtccaac
     2101 tccaactact tttaactttg accgcaacaa ggtgcttgct ttcaggcagc ttgccgctga
     2161 gaacaaatat gggctgatgg acacaatgaa aattgggaaa cagctcaagg atgtcaaaac
     2221 cttgccagaa ctcaaacagg cactcaggaa cacctcaatt aagaagtgcc agatagtgta
     2281 cggtggttcc acttacacgc ttgagtctga tggaaaaggc aatgtgaaag ttgacagagt
     2341 tcaaagcgcc actgtgcaga ccaacaatga gctggccggt gccctacacc atctgaggtg
     2401 tgccagaatc aggtattatg tcaagtgcgt tcaagaggcc ctgtattcca tcattcaaat
     2461 tgccggagcc gcatttgtca ccacgcgcat cgctaagcgc atgaacatac aaaatctctg
     2521 gtctaaaccg caagtggaag acacagaaga caccgccaac aaggacgggt gccccaaacc
     2581 caaagatgat gaagagttcg ttgtctcgtc cgatgacatt aagactgagg gcaagaaggg
     2641 gaagaacaag accggccgtg gcaagaagca cacagccttt tcaagtaaag gccttagtga
     2701 tgaagagtac gatgagtaca aaaggatcag ggaagaaaga aacggcaagt actccataga
     2761 agagtacctt caggacaggg acaagtacta tgaagaggtg gccattgcca gggcgaccga
     2821 ggaggacttc tgtgaagagg aggaggcaaa aattcggcaa aggatcttca gaccaacgag
     2881 gaaacaacgc aaggaagaga gggcctctct tggtctagtc acaggctctg aaattaggaa
     2941 aagaaaccca gatgatttca aacccaaagg aaaactgtgg gctgatgatg acaggagtgt
     3001 tgactataat gagaaacttg attttgaagc cccaccaagc atctggtcga ggatagtcaa
     3061 ttttggttcg ggttggggct tttgggtctc ccccagcctg ttcataacat caactcatgt
     3121 aatacctcag ggtgcacaag agtttttcgg agtgcccatc aaacaaattc agatacacaa
     3181 atcaggtgag ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacaggtat
     3241 gatcctagaa gaaggtgcgc ccgaaggcac tgtggtcaca ctactcatca agaggtcaac
     3301 tggagagctt atgcccctag cagccagaat gggaacccat gcaaccatga aaatccaagg
     3361 acgcactgtt ggaggccaaa tgggtatgct cttgacaggg tccaacgcca agagcatgga
     3421 cctaggcacc acaccaggtg actgtggttg tccctacatt tacaagagag gaaatgacta
     3481 tgtggttatt ggggtccaca cggctgctgc tcgcggtggg aacactgtca tatgtgccac
     3541 ccagggaagt gagggagaag ccacacttga aggcggtgac aacaagggga cctactgcgg
     3601 tgcgccaatc ctaggcccag gaaacgcccc aaaactcagc accaaaacta aattttggag
     3661 atcatccaca gcaccactcc cccctggcac ctatgaaccg gcctatcttg gtggcaagga
     3721 ccctagagta aagggcggcc cctcattgca acaagttatg agggaccagt tgaaaccatt
     3781 cacagaaccc aggggcaaac caccaaagcc aagtgtgttg gaggccgcca agaaaaccgt
     3841 catcaatgtc cttgagcaaa caattgatcc acctgaaaaa tggtcatttg cacaagcctg
     3901 tgcgtctctt gacaagacaa catccagtgg ccatccgcac cacatgcgga aaaatgactg
     3961 ttggaatggg gagtccttca caggcaagtt ggcagaccag gcttctaagg ccaacctgat
     4021 gtttgaagag gggaagaaca tgacaccagt ttacacaggt gcactcaaag atgaactggt
     4081 caaaactgac aagatttatg gcaagatcaa aaagaggctt ctttggggct cggacctagc
     4141 gaccatgatc cggtgcgctc gagcgttcgg aggcttgatg gatgaactca aggcacactg
     4201 tgtcacactt cctgttagag ttggtatgaa catgaatgag gacggcccca tcatctttga
     4261 gaagcactcc agatacaaat accactatga tgctgactac tcacgatggg attcaacaca
     4321 gcagagagcc gtgttagcag cagccctgga aatcatggtt aaattctccc cagaaccaca
     4381 cttggcccaa atagttgcag aagaccttct atctcctagt gtaatggatg tgggagattt
     4441 caagatatct atcaatgagg gccttccctc tggtgtgcct tgcacctcgc aatggaattc
     4501 catcgcccac tggctcctca ccctctgtgc actctctgaa gtcacaaatt tgtcccctga
     4561 tattatacaa gccaattccc tcttctcttt ttatggtgat gatgaaattg tcagtacaga
     4621 cataaaactg gatccagaga aactcacagc aaagctcaag gaatacgggt tgaagccaac
     4681 ccgccctgac aagactgagg gacccctcgt catctctgaa gacttggacg gcctcacctt
     4741 cctgcggcga actgtaaccc gtgacccagc aggttggttt ggaaaactgg agcagagctc
     4801 aattcttagg caaatgtact ggactagagg ccccaatcat gatgacccat ctgaatcaat
     4861 gataccacac tcccaaagac ccatacaatt aatgtctctg ttgggtgagg ccgcacttca
     4921 tggcccagca ttctacagta aaatcagcaa actagtcatt gcagagctga aggaaggtgg
     4981 catggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccag cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggctct ggagcccgtt gttggtgccg ctattgcggc acctgtagcg ggccaacaaa
     5221 acataattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gaattcacag
     5281 tgtcccccag aaatgctcca ggtgaaatac tatggagcgc acctttaggc cctgatttga
     5341 atccctacct ttcccatttg tctagaatgt ataatggtta tgcaggtggt tttgaagtgc
     5401 aagtgatcct cgcggggaac gcgttcaccg ccgggaaggt catatttgca gcagtccctc
     5461 caaactttcc aactgaaggt ctaagcccta gtcaagttac catgttcccc catataattg
     5521 tagatgttag acaattggag cctgtgttga ttcccctacc tgatgttagg aataattttt
     5581 accattacaa tcaaacaaat gaccctacca ttaaattgat agcaatgttg tatacaccac
     5641 ttagagctaa taatgctggg gacgatgtct tcacagtctc ttgtcgagtc ctcacgagac
     5701 catcccctga ttttgacttc atattcttag tgccacccac agttgaatcc agaactaaac
     5761 catttactgt cccaatctta actgttgagg aaatgaccaa ctctagattc cccattcctt
     5821 tggaaaggtt gtacacgggt cccagcagtg cttttgttgt ccagccacaa aatggcaggt
     5881 gcacgactga tggcgtgctc ttaggcacca cccagctgtc tgctgtcaac atctgcacct
     5941 tcagggggga tgtcacccac attacaggct cccgtaatta tacaatgaat ttggcctctc
     6001 aaaattggaa caattatgac ccaacagaag aaattccagc ccctctgggg accccagatt
     6061 ttgtgggaaa gatccaaggc atgctcaccc aaaccacaag aggagatggc tcgactcgtg
     6121 gccacaaagc cacagtgtac actgggagtg ccgacttcgc cccaaaattg ggcagagttc
     6181 aattcgctac tgacacagac aatgattttg aatccaacca aaacacaaaa ttcaccccag
     6241 tcggtgtcat ccaggatggc aacaccaccc atcaaaatga accccaacaa tgggtactcc
     6301 caggttactc aggtagagat ggccacaatg tacacctagc ccctgccgtc gcccccacct
     6361 acccgggtga gcaactcctt ttctttaggt ccaccatgcc cggatgtagc gggtatccca
     6421 acatgaatct agattgctta ctcccccagg aatgggtgca gcacttctac caagaagcag
     6481 ctccagcaca atctgaagtg gctctgctaa gatttgtgaa tccagataca ggtagggttt
     6541 tgtttgagtg caagctccat aaatcagggt atgtcacagt ggctcatact ggtcagcatg
     6601 atttggttat tccccccaat ggttatttta gatttgattc ctgggtcaac cagttttaca
     6661 cacttgcccc catgggaaat ggagcggggc gtagacgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttgg ctctggactt ggttctctaa tcaatgctgg
     6781 ggctggggct atcaaccaaa aagttgagtt tgaaaataac agaaaattac aacaagcttc
     6841 cttccaattt agtagcaatc tacaacaggc ctcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccactc aaaaattgca acaaggttta atgaaggtca aacaggagat
     6961 gcttttagaa ggtggattct ttgaaacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaggct ttggactgga gtggaacaag gtactgggct cctgatgcta ggatcacaac
     7081 atacaatgca ggccgcttct ccacccctca accttcaggg gcattgccag gtagaactaa
     7141 tcttagggcc actgtccccg ctcggggctc ctctagtgca tttcctaata cttcccctgt
     7201 cacttctgtg tattcaaatc aaactgtttc aacgagactt ggttcttcag caggttctgg
     7261 caccagtgtc tcgagtctcc cgtcaactgc aaggactagg ggctgggttg aggatcaaaa
     7321 cagaaatttg tcacctttta tgaggggggc tctcaacaca tcattcgtca ccccaccatc
     7381 tagcagatcc tccagtcaaa gcacagtctc aaccgtgcct aaagaaattt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct catgttcgca agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt cctttcttta gtgtctttt
//