Typing tool

Complete norovirus genomes

GQ845367  GII.4 New Orleans
 GII.P4 New Orleans

Length: 7,559 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       GQ845367                7559 bp    RNA     linear   VRL 02-DEC-2010
DEFINITION  Norovirus Hu/GII.4/Orange/NSW001P/2008/AU, complete genome.
ACCESSION   GQ845367
VERSION     GQ845367.2
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Orange/NSW001P/2008/AU
  ORGANISM  Norovirus Hu/GII.4/Orange/NSW001P/2008/AU
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7559)
  AUTHORS   Eden,J.S., Bull,R.A., Tu,E., McIver,C.J., Lyon,M.J., Marshall,J.A.,
            Smith,D.W., Musto,J., Rawlinson,W.D. and White,P.A.
  TITLE     Norovirus GII.4 variant 2006b caused epidemics of acute
            gastroenteritis in Australia during 2007 and 2008
  JOURNAL   J. Clin. Virol. 49 (4), 265-271 (2010)
   PUBMED   20888289
REFERENCE   2  (bases 1 to 7559)
  AUTHORS   Eden,J.-S., Bull,R.A. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-2009) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
REFERENCE   3  (bases 1 to 7559)
  AUTHORS   Eden,J.-S., Bull,R.A. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-NOV-2010) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
  REMARK    Sequence update by submitter
COMMENT     On Nov 12, 2010 this sequence version replaced GQ845367.1.
FEATURES             Location/Qualifiers
     source          1..7559
                     /organism="Norovirus Hu/GII.4/Orange/NSW001P/2008/AU"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/Orange/NSW001P/2008/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:676524"
                     /country="Australia"
                     /collection_date="2008"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ACX31888.2"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDGVLSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKNIPPPPPNGEDEIVVSYSVKDGVSGLPDLSTVRQPE
                     ESNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LARVELTPLSLYWRPVYTPQYLISPDSLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCALSSLFTRPIKDIIGK
                     IRPLNILNILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDYELQGSED
                     LAVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAIVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTIKALLARNAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMRVGKQLKDVRTM
                     PELKQALKNVSIKKCQIVYSGCTYILESDGKGNVKVDRIQSASVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIVKRMNIQDLWSKPQVENTEETTSKDGC
                     PKSKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPDDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGENTVICATQGSEGEATLEGGDNKGTYCGAPILG
                     PGSAPTLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMREQLKPFTEP
                     RGKPPKPSVLEAAKKTIINALEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKSMTPVYTAALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYTYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSPEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDTIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLR
                     EYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHGDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="major capsid protein"
                     /codon_start=1
                     /product="VP1"
                     /protein_id="ACX31889.1"
                     /translation="MKMASSDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDMNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDPTIKLIAMLYTPLRANNAGDDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFSVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASQNWNSYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTRTDGSTRGHKATVYTGSADFSPKLGRVQFATDTDNDFDANQNTKFTPVGVIQDG
                     NTAHRNEPQQWVLPSYSGRNTHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQYFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="minor capsid protein"
                     /codon_start=1
                     /product="VP2"
                     /protein_id="ADQ20512.1"
                     /translation="MAGAFFAGLASDVLGSGLGSLINAGAGAINQKVEFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFFETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQSSGAPPGRANLRATVPARGSSSISS
                     DSSIATSVHSNQTTSTRLGSTAGSGTSVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPPSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRKRGESRV"
     3'UTR           7514..7559
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acggagtgct ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcctccccc gagggaaata ccacaaagac ccccacgacc
      181 acctactcca gaactggtta aaaatattcc ccctcccccg cccaacggag aggatgaaat
      241 agtggtttct tatagtgtca aagatggtgt ttccggcttg cctgaccttt ccaccgtcag
      301 gcaaccggaa gaatctaaca cggccttcag tgtccctcca ctcaatcaga gggagaatag
      361 agatgctaag gagccactta ctggaacaat tctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgtggagc gaggtcttgt actaggtgtg cacaaaccac cagctgccat
      481 tagcctcgct agggttgagc taacgccact ctccttgtac tggagacctg tgtacactcc
      541 tcagtacctc atctctccag actctctcaa gaaattacac ggagaaacgt tcccctacac
      601 agcctttgac aacaactgtt atgccttttg ttgctgggtc ctggacctaa atgactcgtg
      661 gctgagcagg agaatgatcc agagaacaac tggtttcttc aggccctacc aagactggaa
      721 taggaaaccc cttcccacta tggatgattc caaattaaag aaggtagcta acatattcct
      781 gtgtgctctg tcctcactgt tcaccaggcc cataaaagat ataataggga agataaggcc
      841 tcttaacatc ctcaacatct tagcctcatg tgattggact tttgcaggca tagtggagtc
      901 cctgatactc ttggcagaac tctttggagt tttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg actacgagct acaaggatct gaggaccttg cagtggagct
     1021 cgtccccgtg gtgatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 gaaaatgttg tcatctgctg cgtccacctt gagagcttgt aaagaccttg gtgcttatgg
     1141 gctagagatc ctaaagttgg tcatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 gctggctata gtgaggtcta tcgaggatgc agtcctggat ctcgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagtctggca acctatatga gaacacttga
     1321 ccttgaggag gagaaagcca ggaaactctc aaccaagtct gcctcacctg acatcgtggg
     1381 cacaatcaaa gccctcctgg cgagaaatgc tgccgcacgt tctctggtgc accgagcgaa
     1441 ggaagagctt tccagcagac caagacctgt ggtgttgatg atatcaggca gaccaggaat
     1501 agggaagacc cacctcgcta gggaagtggc taagagaatc gcagcctccc ttacaggaga
     1561 ccagcgtgtg ggcctcatcc cacgcaatgg cgtcgaccat tgggatgcgt acaaggggga
     1621 gagggttgtc ctatgggacg attatggaat gagcaaccct attcacgatg ccctcaggct
     1681 gcaagaactc gctgacactt gccccctcac tctaaactgt gacaggattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcatcattat caccactaat ctggccaacc cagcaccact
     1801 ggactatgtc aactttgaag catgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccctgaagtc gaaaaggcga agcgtgactt cccaggccag cctgacatgt ggaagaacgc
     1921 cttcagttct gatttctcac acataaaact agcactggcc ccacagggtg gtttcgacaa
     1981 gaacgggaac accccacacg gaaagggcgt catgaagact ctcaccactg gctcccttat
     2041 tgcccgggca tcagggctac tccatgagag gttagatgaa tttgaactac agggcccagc
     2101 tctcaccacc ttcaatttcg atcgcaataa agtgcttgcc tttagacaac ttgctgctga
     2161 aaataaatat ggattgatgg acacaatgag agttgggaaa caactcaagg atgtcagaac
     2221 catgccagaa ctcaaacaag cactcaagaa tgtctcaatc aagaagtgcc aaatagtgta
     2281 tagtggttgc acctacatac ttgagtctga tggcaagggc aatgtgaaag ttgacagaat
     2341 ccaaagcgcc tccgtgcaga ccaacaatga gctggctggt gccctgcacc atttgaggtg
     2401 cgccagaatc agatattatg tcaagtgtgt ccaggaggcc ctatattcca tcattcaaat
     2461 tgctggggct gcatttgtca ccacgcgcat cgtcaagcgc atgaacatac aagacctatg
     2521 gtccaagcca caagtggaaa acacagagga gaccaccagc aaggacgggt gcccaaaatc
     2581 caaggatgat gaggagtttg tcatttcatc cgacgacatc aaaactgagg gcaagaaagg
     2641 gaagaacaag actggccgcg gcaagaagca cacagccttt tcaagcaaag gcctcagtga
     2701 tgaagagtac gatgagtaca agaggattag agaagaaagg aatggcaagt actccataga
     2761 agagtacctt caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgactga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttta ggccaacaag
     2881 gaaacaacgc aaggaggaaa gagcttctct cggtctggtc acaggctctg aaattaggaa
     2941 aagaaaccca gatgacttca aacccaaggg gaaattgtgg gctgacgatg acagaagtgt
     3001 ggactacaat gagaaactca gttttgaggc cccaccaagc atctggtcga gaatagtcaa
     3061 ctttggttca ggctggggat tctgggtctc ccccagtctg ttcataacat caacccatgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaatac aggtacacaa
     3181 gtcaggcgag ttctgtcgct tgagattccc aaaaccaatc aggactgatg tgacgggcat
     3241 gatcttagaa gaaggcgcac ctgagggcac cgtggtcaca ctactcatca aaaggtccac
     3301 tggggaactc atgcccctag cagctaggat ggggacccat gcaaccatga agatccaagg
     3361 gcgcactgtt ggaggccaga tgggcatgct tctgacagga tccaacgcca agagcatgga
     3421 cctgggtact acaccaggtg attgtggctg tccctatatc tacaagagag gtaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc acgtggggaa aacactgtca tatgtgccac
     3541 ccaggggagt gaaggagagg ctacacttga aggtggtgac aacaagggga catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aacacttagc accaagacca aattctggag
     3661 gtcgtccaca gcaccgctcc cacctggcac ctatgaacca gcctatcttg gtggcaagga
     3721 ccctagagtc aagggtggtc cttcactgca gcaagtcatg agggaacagt tgaagccatt
     3781 cacagagccc aggggcaaac caccaaagcc aagtgtatta gaagctgcca agaagaccat
     3841 cattaatgcc cttgagcaaa caattgatcc acctgagaaa tggtcattcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttccagtgg tcatccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagagca tgaccccagt ctacacagct gcgctcaagg atgagttagt
     4081 taaaactgac aaaatttatg gtaagatcaa gaagagactt ctctggggct cggacttggc
     4141 gaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcacactg
     4201 tgtcacactt cccattagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaagcattcc aggtacacat atcactatga tgctgattac tctcgatggg actcaacaca
     4321 acagagagcc gtgttggcag cagctctaga aatcatggtt aaattctccc cagaaccaca
     4381 tttggctcag gtagtcgcgg aggaccttct ttctcctagc gtggtggacg tgggcgactt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaattc
     4501 catcgcccac tggcttctca ctctctgtgc gctctctgaa gtcacaaact tgtcccctga
     4561 taccatacag gctaactccc tcttctcttt ttatggtgat gatgaaattg ttagcacaga
     4621 cataaaattg gacccagaga aattgacagc aaagctcagg gaatatgggt taaaaccaac
     4681 ccgccctgac aaaactgaag gaccccttgt catctctgaa gacttgaatg gcctaacttt
     4741 tctgcggaga actgtgaccc gtgacccagc tggttggttt ggaaaactgg agcagagttc
     4801 aatactcagg caaatgtact ggactagggg ccccaaccat ggagacccat ctgaaacaat
     4861 gattccacac tcccaaagac ccatacaatt gatgtcccta ctgggggagg ccgctctcca
     4921 cggcccagca ttttacagca aaatcagcaa attggtcatt gcagagctaa aagaaggtgg
     4981 catggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 gtgacgccaa cccatctgat gggtccacag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gttggtgccg ccattgcggc acctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaacaatt ttgtacaagc ccctggtgga gagtttacag
     5281 tatcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatatga
     5341 atccctacct ttcccatttg gccagaatgt acaatggtta tgcaggtggt tttgaagtgc
     5401 aggtaatcct cgcggggaac gcgttcaccg ccgggaaaat catatttgca gcagtcccac
     5461 caaatttccc aactgaaggt ttgagcccca gccaggtcac tatgttcccc cacataatag
     5521 tagatgttag gcaattggaa cctgtgttga tccccttacc cgatgttagg aataatttct
     5581 accattataa tcaatcaaat gaccccacca tcaaattgat agcaatgttg tatacaccac
     5641 ttagggctaa taatgctggg gacgatgtct tcacagtttc ttgtcgagtt ctcacgagac
     5701 catcccccga ttttgatttc atatttttag tgccacccac agttgaatca agaactaaac
     5761 cattctctgt cccaatttta actgttgagg agatgaccaa ttcaaggttc cccattcctt
     5821 tggaaaagct gttcacgggc cccagtagtg cctttgttgt tcaaccacaa aacggcaggt
     5881 gcacgactga tggcgtgctc ctaggtacta cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccat attgcaggca gtcgtaacta cacaatgaat ctggcttccc
     6001 agaattggaa tagttatgac ccaacagaag aaatcccagc ccctctagga actccagatt
     6061 tcgtggggaa gattcaaggt gtgctcaccc aaaccacaag gacggatggc tcgacccgcg
     6121 gccacaaagc tacagtgtac actgggagcg ccgacttttc tccaaaactg ggtagagttc
     6181 aatttgccac tgacacagac aatgattttg atgctaacca aaacacaaag ttcaccccag
     6241 tcggtgttat ccaggatggt aatactgccc accgaaatga accccagcaa tgggtgctcc
     6301 caagttactc aggcagaaat actcataatg tgcacctggc ccccgctgta gcccccactt
     6361 ttccgggtga gcagctcctc ttcttcagat ctaccatgcc cggatgcagc gggtacccca
     6421 acatggattt ggactgtctg ctcccccagg aatgggtgca gtatttctac caggaggcag
     6481 ccccagcaca atctgatgtg gctctgctaa gatttgtgaa tccagacaca ggtagggttt
     6541 tgtttgagtg taagcttcat aaatcaggct atgttacagt ggctcacact ggccaacatg
     6601 atttggttat cccccccaat ggttatttta gatttgattc ctgggtcaac cagttctaca
     6661 cactcgcccc catgggaaat gggacggggc gtagacgtgc attataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg acgtccttgg ctctggactt ggttccctaa tcaatgctgg
     6781 ggctggggcc atcaaccaaa aagttgaatt tgaaaataac agaaaattgc aacaagcttc
     6841 cttccaattt agtagcaatc tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacca aaaagttgca acaggaaatg atgagagtta aacaagcaat
     6961 gctcctagag ggtggattct ttgagacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaagct ttggactgga gcgggacaag gtactgggct cccgatgcta ggactacaac
     7081 atataatgca ggccgctttt ccacccctca atcctcgggg gcaccaccag gaagagctaa
     7141 tcttagggct actgtccccg cccggggttc ctctagcata tcttctgact cttctattgc
     7201 tacttctgtg cattcaaatc aaaccacttc aacgagactt ggttctacag ctggttctgg
     7261 taccagtgtc tcgagcctcc cgtcaactgc aaggactagg agctgggttg aggatcaaaa
     7321 taggaatttg tcacctttca tgaggggggc ccacaacatc tcgtttgtca ccccaccacc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgccc aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacatccgta agcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt cttttcttta gtgtctttt
//