Typing tool

Complete norovirus genomes

GQ845366  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,560 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       GQ845366                7560 bp    RNA     linear   VRL 06-FEB-2012
DEFINITION  Norovirus Hu/GII.4/Westmead/NSW3639/2008/AUS, complete genome.
ACCESSION   GQ845366
VERSION     GQ845366.2
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Westmead/NSW3639/2008/AUS
  ORGANISM  Norovirus Hu/GII.4/Westmead/NSW3639/2008/AUS
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7560)
  AUTHORS   Eden,J.S., Bull,R.A., Tu,E., McIver,C.J., Lyon,M.J., Marshall,J.A.,
            Smith,D.W., Musto,J., Rawlinson,W.D. and White,P.A.
  TITLE     Norovirus GII.4 variant 2006b caused epidemics of acute
            gastroenteritis in Australia during 2007 and 2008
  JOURNAL   J. Clin. Virol. 49 (4), 265-271 (2010)
   PUBMED   20888289
REFERENCE   2  (bases 1 to 7560)
  AUTHORS   Eden,J.-S., Bull,R.A. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-2009) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
REFERENCE   3  (bases 1 to 7560)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
  REMARK    Sequence update by submitter
COMMENT     On Feb 6, 2012 this sequence version replaced GQ845366.1.
FEATURES             Location/Qualifiers
     source          1..7560
                     /organism="Norovirus Hu/GII.4/Westmead/NSW3639/2008/AUS"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/NSW3639/2008/AU"
                     /host="Homo sapiens"
                     /db_xref="taxon:676537"
                     /country="Australia"
                     /collection_date="2008"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ACX31886.2"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEVVVSYSAKDGVSGLPELSTVRQPE
                     ETNTAFSVPPLNQRENRDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIKLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLMDTMKVGRQLKDVKTM
                     PELKQALKNISIKKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATNKDGC
                     PKPKDIEEFVISSDDIKTEGKKGKNKAGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERVSLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGRPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ACX31887.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSSAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLASLNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSAPFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     GTTHRNEPQQWVLPNYSGRNVPNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPSNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="AEZ56470.1"
                     /translation="MAGAFFAGLASDVLSSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMKVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARTTTYNAGRFSTPQTSGALPGRTNPRAPTPARGSPSTSS
                     NASTATSIYSNQTVSTRLGSTAGSGTNVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
     3'UTR           7514..7560
ORIGIN      
        1 gtgaatgaag atggcctcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acaaaatgtt ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggca cggcctaaac agcccccccc gagggaaata ccacaaagac ccccacgacc
      181 acctactcca gaactggtca aaaagatccc tcctcccccg cccaacgggg aggatgaagt
      241 agtggtttct tatagtgcca aagatggcgt ttccggtctg cctgagcttt ccaccgtcag
      301 gcaaccggaa gaaaccaata cggccttcag tgtccctcca ctcaatcaga gggagaatag
      361 ggatgctaag gaaccactga ctggaacaat tctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgttgagc gaggtcttgt gctgggtgtg cacaaaccac cagctgccat
      481 tagcctcgcc aaggtcgaac taacaccact ctccttgttc tggagacctg tgtacactcc
      541 tcagtacctc atctctccag acactctcaa gaaattacac ggagaaacat tcccctacac
      601 agccttcgac aacaactgct atgccttttg ttgctgggtc ctggatctaa acgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagattggaa
      721 taggaaaccc ctccccacta tggatgattc caaattaaag aaggtagcta atatattcct
      781 gtgcaccctg tcttcgctat tcaccaggcc cataaaagac ataataggga agctaaggcc
      841 tctcaacatc atcaacatcc tggcttcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ttggcagagc tctttggagt cttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg atttcgagtt gcagggacct gaggaccttg tagtggagct
     1021 cgtccctgta gtgatggggg gaattggttt ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg catctacctt gagagcttgc aaagatcttg gtgcatatgg
     1141 gctagagatc ctaaagttag tcatgaagtg gttcttcccg aagaaagagg aagcaaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtactggac cttgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagcctggca acctatatga ggacccttga
     1321 cctcgaggaa gagaaagcca gaaaactctc aaccaagtct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc cgctgcacgc tccctggtgc accgagcgaa
     1441 ggaggagctt tccagtagac caagacctgt agtcttgatg atatcaggca gaccaggaat
     1501 agggaagacc caccttgcta gggaagtggc taagagaatc gcagcctccc tcacaggaga
     1561 ccagcgtgtg ggcctcatcc cacgcaatgg cgtcgatcac tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagcaatccc atccacgacg ccctcaggct
     1681 gcaagaactc gctgacactt gccccctcac tctaaattgt gacaggattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcattatcat cactactaac ctggccaacc cagcaccact
     1801 ggactatgtc aactttgaag cgtgctcgag gcgcatcgac ttcctcgtgt atgcagaagc
     1861 ccccgaggtc gaaaaggcga agcgtgactt cccgggccaa cctgatatgt ggaaaaacgc
     1921 ttttagttct gatttctcac acataaaatt ggcactggct ccacaaggtg gctttgataa
     1981 gaacgggaac accccacacg ggaagggcgt catgaagact ctcaccactg gctccctcat
     2041 tgcccgggca tcggggctgc tccatgagag attggatgag tttgaactac agggcccagc
     2101 tcttaccacc ttcaactttg accgcaacaa agtgcttgcc ttcaggcagc ttgctgctga
     2161 aaacaaatac gggctgatgg acacaatgaa agttgggagg cagctcaagg atgtcaaaac
     2221 catgccagaa cttaaacaag cactcaagaa tatctcaatc aagaagtgcc agattgtgta
     2281 tagtggttgc acctacacac ttgagtctga tggtaagggc aatgtgaaag ttgacagggt
     2341 tcagagcact tccgttcaga ccaacaatga gctggctggc gccctgcacc atctaaggtg
     2401 cgctagaatc aggtactatg tcaagtgtgt tcaggaggcc ctgtattcta tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat catcaagcgt gtgaacattc aagacttatg
     2521 gtccaagcca caagtggaaa acacagagga ggctaccaac aaggacgggt gcccaaaacc
     2581 caaagatatt gaggagttcg tcatttcatc tgacgacatt aaaactgagg gtaagaaagg
     2641 gaagaacaag gctggccgtg gcaagaagca cacagccttc tcaagtaaag gtctcagtga
     2701 tgaagagtat gatgagtaca agagaattag agaggaaagg aatggcaagt actccataga
     2761 agagtaccta caggacaggg acaaatacta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttca gaccaacaag
     2881 gaaacaacgc aaggaagaaa gagtttctct tggtctagtc acaggttctg aaattaggaa
     2941 aaggaaccca gaagacttca agcctaaggg gaaattatgg gctgacgatg acagaagtgt
     3001 ggactacaat gaaaaactca gctttgaggc cccaccaagc atctggtcaa ggatagtcaa
     3061 ctttggctca ggttggggct tctgggtctc ccccagcctg ttcataacat caacccacgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaatcc aggtacacaa
     3181 gtcaggcgaa ttttgtcgct tgaggttccc aaaaccaatc aggactgatg tgactggcat
     3241 gatcttggaa gaaggcgcgc ccgaaggtac cgtggtcaca ctactcatca aaaggtctac
     3301 tggagaactc atgcccctag cagctagaat ggggacccat gcaaccatga agattcaagg
     3361 gcgcactgtt ggaggtcaga tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 tctaggcacc acaccaggtg attgcggctg tccctacatc tacaagagag gaaatgacta
     3481 tgtggtcatt ggagtccaca cggctgccgc tcgtggggga aacactgtca tatgtgccac
     3541 ccaggggggt gagggggaag ctacacttga aggtggtgac agtaagggaa catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaaaacca aattctggag
     3661 atcatccaca gcaccactcc cacctggcac ctatgaacca gcctacctag gtggcaagga
     3721 ccccagggtc aagggtggcc cctcgttgca gcaagtcatg agggaccagc tgaaaccatt
     3781 tacagagcct aggggcaggc caccaaagcc aagcgtgtta gaagctgcca agaaaaccat
     3841 catcaatgtc cttgaacaaa caatcgaccc acctgagaag tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttctagcgg tcacccgcac cacatgcgga aaaacgactg
     3961 ctggaacggg gaatcattca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaagaaca tgaccccagt ctacacaggt gcacttaagg atgaactagt
     4081 caaaactgac aaaatttatg gtaagattaa gaagaggctt ctctggggct cggatttagc
     4141 aaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcacactg
     4201 tgtcacactc cctatcagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaagcattcc aggtacagat accactatga tgctgattac tctcggtggg attcaacaca
     4321 acagagagcc gtgctggcag ctgctctaga aatcatggtt aaattctctt cagaaccaca
     4381 tttggctcag gtagtagcag aagacctcct ttctcctagc gtggtggatg taggtgactt
     4441 cacaatatca atcaacgagg gtcttccctc tggggtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc actctccgaa gttacaaact tgtccccaga
     4561 catcatacag gctaattctc tcttctcctt ctatggtgat gatgaaattg ttagtacaga
     4621 cataaaatta gacccagaga agttgacagc aaagcttaag gaatacgggt tgaaaccaac
     4681 tcgccctgat aaaactgaag gacctcttgt tatttctgaa gacttagacg gtttgacttt
     4741 tctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaagctgg agcagagctc
     4801 aatactcagg caaatgtact ggactagggg ccccaaccat gaagatccat ctgaatcaat
     4861 gattccacac tctcaaagac ccatacaatt gatgtcctta ctgggagagg ccgcactcca
     4921 cggcccaaca ttctacagta aaatcagcaa attagtcatt gcagagttaa aagaaggtgg
     4981 tatggatttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gtcggtgccg ctattgcggc gcctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtgga gagttcacag
     5281 tgtcccctag aaacgctcca ggtgaaatac tatggagcgc gcccttaggc cctgatctta
     5341 atccctacct atctcatttg gccagaatgt ataatggtta tgcaggtggt tttgaagtgc
     5401 aggtgatcct cgcggggaac gcgttcaccg ccggaaaaat tatatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ttgagtccca gccaggtcac tatgttcccc cacataatag
     5521 tggatgttag gcaattggaa cctgtgttga tccccctacc tgatgttagg aataacttct
     5581 atcactataa tcagtcaaat gattctacca ttaaattgat agcaatgctg tatacaccac
     5641 ttagggctaa taatgctggg gaagatgtct ttacagtctc ttgtcgagtt ctcacgaggc
     5701 catcccctga ttttgatttt atatttttgg tgccacctac agttgagtca agaactaaac
     5761 catttactgt cccaatctta actgttgaag aaatgaccaa ttcaagattc cccattcctt
     5821 tggaaaaatt gttcacgggt cccagcagtg cctttgttgt ccaaccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ttaggcacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac attgcaggct ctcgtaatta cacaatgaat ttggcttccc
     6001 taaattggaa caattatgac ccaacagaag aaattccagc ccctctagga actccagatt
     6061 tcgtgggaaa gatccaaggt gtgctcactc aaaccacaaa gggagatggc tcgacccgtg
     6121 gccataaagc tacagtctac actgggagtg ccccctttac tccaaagctg ggcagtgtcc
     6181 aattcagtac tgacacagaa aatgattttg aaactcacca aaacacaaaa ttcaccccag
     6241 tcggtgtcat ccaggatggt ggcaccaccc accgaaatga accccaacaa tgggtgctcc
     6301 caaattattc aggtagaaat gtccctaatg tacacctagc ccctgctgta gcccccactt
     6361 ttccgggtga acaacttctt ttctttaggt ccactatgcc cggatgtagc gggtatccca
     6421 acatggattt ggattgccta ctcccccagg agtgggtgca gcacttctac caagaggcag
     6481 ctccagcaca atctgatgtg gctctattga gatttgtgaa tccagacacg ggtagggtcc
     6541 tgtttgagtg caaacttcat aaatcaggct atgtcacagt ggctcatact ggccagcatg
     6601 atttggtcat cccctccaat ggttatttta ggtttgattc ctgggttaat caattctaca
     6661 cacttgcccc catgggaaat gggacggggc gtagacgtgc tttataatgg ctggagcttt
     6721 ctttgctgga ttggcatctg atgtccttag ctctggactt ggttccctaa tcaatgctgg
     6781 ggctggggct atcaaccaaa agattgattt tgaaaataat agaaagttgc agcaagcttc
     6841 cttccagttt agcagtaatt tacaacaggc ttcctttcaa catgataaag agatgctcca
     6901 agcacaaatt gaggccacta aaaagttgca acaggaaatg atgaaagtca aacaggcaat
     6961 gctcttagaa ggtggattct ctgaaacaga tgcagcccgt ggggcaatca atgcccctat
     7021 gacaaaggct ttggactgga gcggaacaag gtactgggcc cctgatgcta ggactacaac
     7081 atacaatgca ggccgttttt ccacccctca aacttcgggg gcactgccag gaagaactaa
     7141 tcccagggct cctacccccg ctcggggctc ccccagcaca tcttctaatg cttctactgc
     7201 tacttccata tattcaaatc aaactgtttc aacgagactt ggttctacag ctggttctgg
     7261 caccaatgtc tcgagtctcc catcaactgc aaggactagg agttgggttg aggatcaaaa
     7321 cagaaatttg tcacctttca tgaggggggc tcacaacata tcgtttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta ggcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaatt gattatcttt ccctttcttt agtgtctttt
//