Typing tool

Complete norovirus genomes

GQ845024  GII.4 Den Haag
 GII.P4 Den Haag

Length: 7,562 | 3 CDS

ORF1: 5..5104
ORF2: 5085..6707
ORF3: 6707..7513
LOCUS       GQ845024                7562 bp    RNA     linear   VRL 06-FEB-2012
DEFINITION  Norovirus Hu/GII.4/Rathmines/NSW287R/2007/AUS, complete genome.
ACCESSION   GQ845024
VERSION     GQ845024.2
KEYWORDS    .
SOURCE      Norovirus Hu/GII.4/Rathmines/NSW287R/2007/AUS
  ORGANISM  Norovirus Hu/GII.4/Rathmines/NSW287R/2007/AUS
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Picornavirales; Caliciviridae; Norovirus.
REFERENCE   1  (bases 1 to 7562)
  AUTHORS   Eden,J.S., Bull,R.A., Tu,E., McIver,C.J., Lyon,M.J., Marshall,J.A.,
            Smith,D.W., Musto,J., Rawlinson,W.D. and White,P.A.
  TITLE     Norovirus GII.4 variant 2006b caused epidemics of acute
            gastroenteritis in Australia during 2007 and 2008
  JOURNAL   J. Clin. Virol. 49 (4), 265-271 (2010)
   PUBMED   20888289
REFERENCE   2  (bases 1 to 7562)
  AUTHORS   Eden,J.-S., Bull,R.A., Tu,E.T.V., McIver,C.J., Lyon,M.J.,
            Marshall,J.A., Smith,D.W., Musto,J., Rawlinson,W.D. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-AUG-2009) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
REFERENCE   3  (bases 1 to 7562)
  AUTHORS   Eden,J.-S. and White,P.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2012) School of Biotechnology & Biomolecular
            Sciences, University of New South Wales, Anzac Parade, Sydney, NSW
            2052, Australia
  REMARK    Sequence update by submitter
COMMENT     On Feb 6, 2012 this sequence version replaced GQ845024.1.
FEATURES             Location/Qualifiers
     source          1..7562
                     /organism="Norovirus Hu/GII.4/Rathmines/NSW287R/2007/AUS"
                     /mol_type="genomic RNA"
                     /strain="Hu/GII.4/NSW287R/2007/AUS"
                     /host="Homo sapiens"
                     /db_xref="taxon:676036"
                     /country="Australia"
                     /collection_date="2007"
                     /note="genotype: GII.4"
     5'UTR           1..4
     CDS             5..5104
                     /note="ORF1"
                     /codon_start=1
                     /product="non-structural polyprotein"
                     /protein_id="ACW19926.2"
                     /translation="MKMASNDASAAAVANSNNDTAKSSSDKMFSSMAVTFKRALGARP
                     KQPPPREIPQRPPRPPTPELVKKIPPPPPNGEDEVVVSYSAKDGVSGLPELFTVRQPE
                     ETNTAFSVPPLNQRENKDAKEPLTGTILEMWDGEIYHYGLYVERGLVLGVHKPPAAIS
                     LAKVELTPLSLFWRPVYTPQYLISPDTLKKLHGETFPYTAFDNNCYAFCCWVLDLNDS
                     WLSRRMIQRTTGFFRPYQDWNRKPLPTMDDSKLKKVANIFLCTLSSLFTRPIKDIIGK
                     LRPLNIINILASCDWTFAGIVESLILLAELFGVFWTPPDVSAMIAPLLGDFELQGPED
                     LVVELVPVVMGGIGLVLGFTKEKIGKMLSSAASTLRACKDLGAYGLEILKLVMKWFFP
                     KKEEANELAMVRSIEDAVLDLEAIENNHMTTLLKDKDSLATYMRTLDLEEEKARKLST
                     KSASPDIVGTINALLARIAAARSLVHRAKEELSSRPRPVVLMISGRPGIGKTHLAREV
                     AKRIAASLTGDQRVGLIPRNGVDHWDAYKGERVVLWDDYGMSNPIHDALRLQELADTC
                     PLTLNCDRIENKGKVFDSDVIIITTNLANPAPLDYVNFEACSRRIDFLVYAEAPEVEK
                     AKRDFPGQPDMWKNAFSSDFSHIRLALAPQGGFDKNGNTPHGKGVMKTLTTGSLIARA
                     SGLLHERLDEFELQGPALTTFNFDRNKVLAFRQLAAENKYGLIDTMKVGRQLKDVKTM
                     PELKQALKNISINKCQIVYSGCTYTLESDGKGNVKVDRVQSTSVQTNNELAGALHHLR
                     CARIRYYVKCVQEALYSIIQIAGAAFVTTRIIKRVNIQDLWSKPQVENTEEATNKDGC
                     PKPKDDEEFVISSDDIKTEGKKGKNKTGRGKKHTAFSSKGLSDEEYDEYKRIREERNG
                     KYSIEEYLQDRDKYYEEVAIARATEEDFCEEEEAKIRQRIFRPTRKQRKEERASLGLV
                     TGSEIRKRNPEDFKPKGKLWADDDRSVDYNEKLSFEAPPSIWSRIVNFGSGWGFWVSP
                     SLFITSTHVIPQGAKEFFGVPIKQIQVHKSGEFCRLRFPKPIRTDVTGMILEEGAPEG
                     TVVTLLIKRSTGELMPLAARMGTHATMKIQGRTVGGQMGMLLTGSNAKSMDLGTTPGD
                     CGCPYIYKRGNDYVVIGVHTAAARGGNTVICATQGGEGEATLEGGDSKGTYCGAPILG
                     PGSAPKLSTKTKFWRSSTAPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEP
                     RGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFAQACASLDKTTSSGHPHHMRKNDCW
                     NGESFTGKLADQASKANLMFEEGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDL
                     ATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFEKHSRYRYHYDADYSRWD
                     STQQRSVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFTISINEGLPSGVPCT
                     SQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLK
                     EYGLKPTRPDKTEGPLVISEDLDGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGP
                     NHEDPSESMIPHSQRPIQLMSLLGEAALHGPTFYSKISKLVIAELKEGGMDFYVPRQE
                     PMFRWMRFSDLSTWEGDRNLAPSFVNEDGVE"
     CDS             5085..6707
                     /note="VP1"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="ACW19927.1"
                     /translation="MKMASNDANPSDGSAANLVPEVNNEVMALEPVVGAAIAAPVAGQ
                     QNVIDPWIRNNFVQAPGGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGG
                     FEVQVILAGNAFTAGKIIFAAVPPNFPTEGLSPSQVTMFPHIIVDVRQLEPVLIPLPD
                     VRNNFYHYNQSNDSTIKLIAMLYTPLRANNAGEDVFTVSCRVLTRPSPDFDFIFLVPP
                     TVESRTKPFTVPILTVEEMTNSRFPIPLEKLFTGPSGAFVVQPQNGRCTTDGVLLGTT
                     QLSPVNICTFRGDVTHIAGSRNYTMNLAALNWNNYDPTEEIPAPLGTPDFVGKIQGVL
                     TQTTKGDGSTRGHKATVYTGSADFTPKLGSVQFSTDTENDFETHQNTKFTPVGVIQDG
                     STTHRNEPQQWVLPSYSGRNVHNVHLAPAVAPTFPGEQLLFFRSTMPGCSGYPNMDLD
                     CLLPQEWVQHFYQEAAPAQSDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLV
                     IPPNGYFRFDSWVNQFYTLAPMGNGTGRRRAL"
     CDS             6707..7513
                     /note="VP2"
                     /codon_start=1
                     /product="minor capsid protein"
                     /protein_id="AEZ56469.1"
                     /translation="MAGALFAGLASDVLGSGLGSLINAGAGAINQKIDFENNRKLQQA
                     SFQFSSNLQQASFQHDKEMLQAQIEATKKLQQEMMRVKQAMLLEGGFSETDAARGAIN
                     APMTKALDWSGTRYWAPDARITTYNAGRFSSPQPSGALPGRINLRAPTPARGSSSTSS
                     NSSTATSIYSNQTASTRLGFAAGSGTNVSSLPSTARTRSWVEDQNRNLSPFMRGAHNI
                     SFVTPPSSRSSSQGTVSTVPKEVLDSWTGAFNTRRQPLFAHIRRRGESRV"
     3'UTR           7514..7562
ORIGIN      
        1 gtgaatgaag atggcgtcta acgacgcttc cgctgccgct gttgctaaca gcaacaacga
       61 caccgcaaaa tcttcaagtg acaaaatgtt ttctagcatg gctgtcactt ttaaacgagc
      121 cctcggggcg cggcctaaac agcccccccc gagggaaata ccacaaagac ccccacgacc
      181 acctactcca gaactggtca aaaagatccc tcctcccccg cccaacgggg aggatgaagt
      241 agtggtttct tatagtgcca aagatggcgt ttccggttta cctgagcttt tcaccgtcag
      301 gcaaccggaa gaaaccaata cggctttcag tgtccctcca ctcaaccaga gggagaataa
      361 agatgctaag gaaccactga ctggaacaat tctggaaatg tgggatggag aaatctacca
      421 ttatggcctg tatgttgagc gaggtcttgt gctgggtgtg cacaaaccac cagctgccat
      481 aagcctcgcc aaggtcgaac taacaccact ctccttgttc tggagacctg tgtacactcc
      541 ccagtacctc atctctccag acactctcaa gaaattacac ggagaaacgt ttccctacac
      601 agcctttgac aacaattgct atgccttttg ttgctgggtc ctggatctaa atgactcgtg
      661 gctgagtagg agaatgatcc agagaacaac tggcttcttc agaccctacc aagactggaa
      721 taggaaaccc ctccccacta tggatgattc caaattaaag aaggtagcta acatattcct
      781 gtgcaccctg tcttcgctat tcaccagacc cataaaagac ataataggaa agttaaggcc
      841 tctcaacatc atcaacatcc tggcttcatg tgattggact ttcgcaggca tagtggagtc
      901 cttgatactc ttggcagagc tctttggagt cttctggaca cccccagatg tgtctgcgat
      961 gattgccccc ttactcggtg atttcgagtt acaaggacct gaggaccttg tagtggagct
     1021 cgtccctgta gtaatggggg gaattggtct ggtgctagga ttcaccaaag agaagattgg
     1081 aaaaatgttg tcatctgctg cgtccacctt gagagcttgt aaagatcttg gtgcatatgg
     1141 gctagagatc ctaaagttag tcatgaagtg gttcttcccg aagaaagagg aggcaaatga
     1201 actggctatg gtgagatcca tcgaggatgc agtactggac cttgaggcaa ttgaaaacaa
     1261 ccatatgacc accttgctca aagacaaaga cagtctggca acctacatga gaacccttga
     1321 cctcgaggaa gagaaagcca gaaaactctc aaccaaatct gcttcacctg acatcgtggg
     1381 cacaatcaac gcccttctgg cgagaatcgc cgctgcacgc tccctggtgc accgagcgaa
     1441 ggaggagctt tccagcagac caagacctgt agtcttgatg atatcaggca gaccagggat
     1501 agggaaaacc caccttgcta gggaagtggc taagagaatc gcagcctccc tcacaggaga
     1561 ccagcgtgta ggcctcatcc cacgcaatgg cgtcgatcac tgggatgcgt acaaggggga
     1621 gagggtcgtc ctatgggacg actatggaat gagcaacccc atccacgacg cccttaggct
     1681 gcaagaactc gctgacactt gcccccttac tctaaattgt gacaggattg agaataaagg
     1741 aaaggtcttt gacagcgatg tcatcattat cactactaat ctggccaacc cagcaccact
     1801 ggactatgtc aactttgaag cgtgctcgag gcgcatcgat ttccttgtgt atgcagaagc
     1861 ccccgaggtc gaaaaggcga agcgtgactt cccgggccaa cctgacatgt ggaaaaacgc
     1921 ttttagttct gatttctcac acataagatt ggcactggct ccacaaggtg gctttgataa
     1981 gaacgggaac accccacacg ggaagggcgt catgaagact ctcaccactg gctccctcat
     2041 tgcccgggca tcagggctgc tacatgagag attggatgag tttgaactac agggcccagc
     2101 tcttaccacc ttcaactttg accgcaacaa agtgcttgcc ttcaggcagc ttgctgctga
     2161 aaacaaatat gggttgatag acacaatgaa agttgggagg cagctcaagg atgtcaaaac
     2221 tatgccagaa cttaaacaag cactcaaaaa catctcaatc aataagtgcc agattgtgta
     2281 tagtggttgc acctacacac ttgagtctga tggcaagggc aatgtgaaag ttgacagagt
     2341 tcagagcacc tccgtacaga ccaacaatga gctggctggc gccctgcacc atctgaggtg
     2401 cgccagaatc aggtactatg tcaagtgtgt ccaggaggcc ctgtattcta tcatccagat
     2461 tgctggggct gcatttgtca ccacgcgcat catcaagcgt gtgaacattc aagacttatg
     2521 gtccaagcca caagtggaaa acacagagga ggctaccaac aaggacgggt gcccaaaacc
     2581 caaagatgat gaggagttcg tcatttcatc tgacgacatt aaaactgagg gtaagaaagg
     2641 gaagaacaag actggccgtg gcaagaagca cacagccttc tcaagtaaag gtctcagtga
     2701 tgaagagtat gatgagtaca agagaattag agaggaaagg aatggcaagt actccataga
     2761 agagtacctt caggacaggg acaaatatta tgaggaggtg gccattgcca gggcgaccga
     2821 ggaagacttc tgtgaagagg aggaggccaa gatccggcaa aggatcttca gaccaacaag
     2881 gaaacaacgc aaggaagaaa gagcttctct cggtttagtc acaggttctg aaattaggaa
     2941 aagaaaccca gaagacttca agcccaaggg gaaactatgg gctgacgatg acagaagtgt
     3001 ggactacaat gagaaactca gttttgaggc cccaccaagc atctggtcaa ggatagtcaa
     3061 ctttggttca ggttggggct tctgggtctc ccctagcctg ttcataacat cgacccacgt
     3121 cataccccag ggcgcaaagg agttctttgg agtccccatc aaacaaattc aggtacacaa
     3181 gtcaggcgaa ttctgtcgct tgaggttccc aaaaccaatc aggactgatg tgactggcat
     3241 gatcctggaa gaaggtgcgc ccgaaggcac cgtggtcaca ctactcatca aaaggtctac
     3301 tggagaactc atgcccctag cagctagaat ggggacccat gcaaccatga agattcaagg
     3361 gcgcactgtt ggaggccaga tgggcatgct tctgacagga tccaacgcca aaagcatgga
     3421 tctaggcacc acaccaggtg attgcggctg tccctacatc tacaagagag gaaatgacta
     3481 tgtagtcatt ggagtccaca cggctgccgc tcgcggggga aacactgtca tatgtgccac
     3541 ccaggggggc gagggggaag ctacacttga aggtggtgac agtaagggaa catactgtgg
     3601 tgcaccaatc ctaggcccag ggagtgcccc aaaacttagc accaaaacca aattctggag
     3661 atcatccaca gcaccactcc cacctggcac ctatgaacca gcctaccttg gtggcaagga
     3721 ccccagagtc aagggtggcc cttcgttgca gcaagtcatg agggaccagc tgaaaccatt
     3781 tacagaaccc aggggtaagc caccaaagcc aagtgtgtta gaagctgcca agaaaaccat
     3841 catcaatgtc cttgaacaaa caattgaccc acctgagaag tggtcgttcg cacaagcttg
     3901 cgcgtccctt gacaagacca cttctagcgg ccatccgcac catatgcgga aaaacgactg
     3961 ctggaacggg gagtccttca caggcaagct ggcagaccag gcttccaagg ccaacctgat
     4021 gtttgaagaa gggaaaaaca tgaccccagt ctacacaggt gcacttaagg atgaattagt
     4081 caaaactgac aaaatttatg gtaagatcaa gaagaggctt ctctggggct ctgatttagc
     4141 aaccatgatc cggtgtgctc gagcattcgg aggcctaatg gatgaactca aagcacactg
     4201 tgtcacactt cctatcagag ttggtatgaa tatgaatgag gatggcccca tcatcttcga
     4261 gaagcattcc aggtacagat accactatga tgctgattac tctcggtggg attcaacaca
     4321 acagagaagc gtgctggcag ctgctctaga aatcatggtt aaattctcct cagaaccaca
     4381 tttggcccag gtagtcgcag aagaccttct ttctcctagc gtggtggatg tgggtgactt
     4441 cacaatatca atcaacgagg gtcttccctc tggagtgccc tgcacctccc aatggaactc
     4501 catcgcccac tggcttctca ctctctgtgc actctccgaa gtcacaaatt tgtccccaga
     4561 catcatacag gctaattctc tcttctcctt ctatggtgat gatgaaattg ttagtacaga
     4621 cataaaatta gacccagaga agttgacagc aaagcttaag gaatatgggt tgaaaccaac
     4681 ccgccctgac aaaactgaag gacctcttgt tatttctgaa gacttagatg gtttgacttt
     4741 cctgcggaga actgtgaccc gcgacccagc tggttggttt ggaaaactgg agcagagctc
     4801 aatactcagg caaatgtact ggactagggg ccccaaccat gaagatccat ctgaatcaat
     4861 gattccacac tctcagagac ccatacaatt gatgtcctta ctgggagagg ccgcactcca
     4921 cggcccaaca ttctacagta aaatcagcaa attagtcatt gcagagctaa aagaaggtgg
     4981 tatggacttt tacgtgccca ggcaagagcc aatgttcaga tggatgagat tctcagatct
     5041 gagcacgtgg gagggcgatc gcaatctggc tcccagtttt gtgaatgaag atggcgtcga
     5101 atgacgccaa cccatctgat gggtccgcag ccaacctcgt cccagaggtc aacaatgagg
     5161 ttatggcttt ggagcccgtt gtcggtgccg ctattgcggc gcctgtagcg ggccaacaaa
     5221 atgtaattga cccctggatt agaaataatt ttgtacaagc ccctggtggg gagttcacag
     5281 tatcccctag aaacgctcca ggcgaaatac tatggagcgc gcccttaggc cctgatctga
     5341 atccctacct atctcatttg gccagaatgt ataatggtta tgcaggtggt tttgaagtgc
     5401 aggtgatcct cgcggggaac gcgttcaccg ccggaaaaat tatatttgca gcagtcccac
     5461 caaattttcc aactgaaggc ttgagcccca gccaggttac tatgttcccc cacataatag
     5521 tagatgttag acaattggaa cctgtgttga tccccttacc tgatgttagg aataacttct
     5581 accattataa tcagtcaaat gattctacca ttaaattgat agcaatgctg tatacaccac
     5641 ttagggctaa taatgctggg gaagatgtct tcacagtctc ttgtcgagtc ctcacgaggc
     5701 catcccccga ttttgatttc atatttttgg tgccacctac agttgagtca agaactaaac
     5761 catttactgt cccaatctta actgttgaag aaatgactaa ttcaagattc cccattcctt
     5821 tggaaaagtt gttcacgggt cccagcggtg cctttgttgt tcagccacaa aatggcagat
     5881 gcacgactga tggcgtgctc ctaggcacca cccaactgtc tcctgtcaac atctgcacct
     5941 tcagagggga tgtcacccac attgcaggtt ctcgtaacta cacaatgaat ttggctgctc
     6001 taaattggaa caattatgac ccaacagaag aaattccagc ccctctggga actccagatt
     6061 tcgtgggaaa gatccaaggt gtgctcactc aaaccacaaa gggagatggc tcgacccgtg
     6121 gccataaagc tacagtttac actgggagtg ccgacttcac tccaaagctg ggcagtgttc
     6181 aattcagcac tgatacagaa aatgattttg aaactcacca aaacacaaaa ttcaccccag
     6241 tcggtgtcat ccaggatggc agcaccaccc accgaaatga accccaacaa tgggtgctcc
     6301 caagttattc aggtagaaat gtccataatg tacacctagc ccctgctgta gcccccactt
     6361 ttccgggtga acaacttctt ttcttcaggt ccactatgcc cggatgcagc gggtatccca
     6421 acatggattt ggattgccta ctcccccagg agtgggtgca gcacttctac caagaggcag
     6481 ccccagcaca atctgatgtg gctctattga gatttgtgaa tccagacacg ggtagggtcc
     6541 tgtttgagtg caaacttcat aaatcaggct atgtcacagt ggctcacacc ggccagcacg
     6601 atttggtcat cccccccaat ggctatttta ggtttgattc ctgggttaat caattctaca
     6661 cacttgcccc catgggaaat ggaacggggc gtagacgtgc tttataatgg ctggagcttt
     6721 atttgctgga ttggcatctg atgtccttgg ctctgggctt ggttccctga tcaatgctgg
     6781 ggctggggct atcaaccaaa agattgattt tgaaaataac agaaaattgc agcaagcttc
     6841 cttccagttt agcagtaatc tacaacaggc ttcctttcaa catgacaaag agatgctcca
     6901 agcacaaatt gaggccacta aaaagttgca acaggaaatg atgagagtca aacaggcaat
     6961 gctcttagaa ggtggattct ctgaaacaga tgcagcccgt ggggcaatca acgcccccat
     7021 gacaaaggct ttggactgga gcggaacaag gtactgggcc cctgatgcta ggattacaac
     7081 atacaatgcg ggccgctttt cctcccctca accttcgggg gcactgccag gaagaatcaa
     7141 tctcagggct cctacccccg ctcggggctc ctccagcaca tcttctaatt cttctactgc
     7201 tacttctata tattcaaatc aaactgcttc aacgagactt ggttttgcag ctggttctgg
     7261 caccaatgtc tcgagtctcc cgtcaactgc aaggactagg agttgggttg aggatcaaaa
     7321 cagaaatttg tcacctttca tgaggggggc tcacaacata tcttttgtca ccccaccatc
     7381 tagcagatcc tctagccaag gcacagtctc aaccgtgcct aaagaagttt tggactcctg
     7441 gactggcgct ttcaacacgc gcaggcagcc tctcttcgct cacattcgta ggcgagggga
     7501 gtcacgggtg taatgtgaaa agacaaaaat tgattatctt ttatttttct ttagtgtctt
     7561 tt
//